KEGG   Pyrococcus sp. ST04: Py04_0043Help
Entry
Py04_0043         CDS       T02124                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pys  Pyrococcus sp. ST04
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39550..41019)
Genome map
AA seq 489 aa AA seqDB search
MGVVLALDEGTTSARAIVFDREGNVRGIGQFEFPQYYPRPGWVEHNPEEIWEAQIKAIKV
AVENAKVSPEEVVAIGITNQRETTIIWDKNGRPLYNAIVWQCRRTAEMIEEIKREYGELI
KEKTGLVPDAYFSASKIKWLLDNVPGLREKANKGEVYFGTVDTFLIYRLTGEHVTDYSNA
SRTMLFNIKRLEWDEELLEIFKIPESILPEVKNSSEIYGYTKILGKEVPVSGDAGDQQAA
LFGQAAFEEGMVKATYGTGNFILVNTGKKILYSDNLLTTIAWGLNGKVTYALEGSVFITG
AAVQWLRDGIKIISSASETEELAQKLESNEGVYFVPAFVGLGAPYWDQFARGLIIGITRG
TGREHLARATLEAIAYLTRDVVEEMEKLIEIKELRVDGGATANNFLMQFQADILGKRVIR
PAVRETTALGAAYLAGLAVDFWKDLEEITALWKSERIFEPRMDEAMRNKLYRGWKEAVKR
ALGWAKVVE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgggggttgttttggcacttgacgaggggacgacatctgcaagggctatagtatttgat
agggaaggaaatgttcgaggaattggccaatttgaattcccccagtactatccaaggccg
ggatgggttgaacataatccagaagaaatatgggaggctcagatcaaggcgataaaggtt
gcagtggagaacgccaaagtttctccagaggaagttgtggcaattggaataacgaaccaa
agagaaactactataatttgggacaaaaatgggaggccactgtacaatgctatagtctgg
cagtgcagaagaactgcagagatgattgaggaaataaagagggagtatggcgaattaata
aaagagaaaactggtctagttccagatgcatatttctctgctagcaaaataaaatggttg
cttgacaatgttcctggacttagagagaaggctaataagggagaggtttattttggaaca
gttgatacgttcttaatctacaggcttacaggtgaacatgttaccgattattcaaatgca
tcaaggacaatgctcttcaacataaaaaggctcgaatgggatgaggagcttcttgaaata
tttaagatccctgagagcatacttcctgaggtcaagaattcaagtgaaatttacggttat
accaagatccttggaaaggaggttccggtaagtggtgatgccggtgaccagcaggctgcc
ctattcggacaagctgcctttgaagaaggcatggtgaaagcaacatatgggactggtaat
tttattcttgtcaatactggaaagaagatattgtattctgacaatctgctcacaacgatt
gcttgggggttaaatggaaaggtaacctatgctttagaagggagcgtattcataactggt
gccgcggttcaatggcttagggatggaataaagataatatcttcagcttcagaaacagaa
gaactagcccagaagcttgagagtaatgaaggagtttactttgttccagcttttgttggt
cttggagcaccttactgggatcaatttgcaagagggctaataattgggatcacgagggga
accggaagagaacatcttgctagggcaacacttgaggcgatagcatatctaacaagggat
gttgttgaggagatggagaagctcattgaaataaaagagcttagagttgacggaggggca
actgcaaacaactttctcatgcagttccaagctgatattcttggaaagcgagtaattagg
ccagcggttagagagactacggctttaggtgctgcataccttgctggtctagcggttgac
ttttggaaagatcttgaagaaataacggcactctggaagtctgagagaatatttgagcct
agaatggatgaagccatgcggaataagctctataggggatggaaagaggcagttaagagg
gctttaggttgggctaaagttgtggaatga

DBGET integrated database retrieval system