KEGG   Pyrococcus sp. ST04: Py04_0127Help
Entry
Py04_0127         CDS       T02124                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K01505  
1-aminocyclopropane-1-carboxylate deaminase [EC:3.5.99.7]
Organism
pys  Pyrococcus sp. ST04
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Py04_0127
Enzymes [BR:pys01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.7  1-aminocyclopropane-1-carboxylate deaminase
     Py04_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(124270..125268)
Genome map
AA seq 332 aa AA seqDB search
MHPKIASLLAKFPRVELIPWETPIQYLPKVSEMLGVEVYIKRDDLTGLGIGGNKVRKLEY
LLGDALAKGADVVITMGAVHSNHAFVTALAAKKLGLDAVLVLRGKEVLRGNYLLDKLMGV
ETRIYEAENSFELMKYAEEVAEELREQGKRPYIIPVGGASPIGTLGYVRAVGEIATQSAV
LGLEFDTIVDAVGSGGTIAGLALGLALAGMKTRPVGMAVGLFGEKMVQRIEDLLRETSEL
LGVKVKVEVPEIYDYSFGAYGKIVREVSEIIRLVGTKEGILLDPVYTGKAFYGLIDRAKK
GDLGEKILFVHTGGISGLFHYGEDMLKLLGKV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcacccaaaaatagcttccttgcttgctaagtttccaagagttgaactgataccatgg
gaaactccgattcagtatcttcccaaggtaagtgaaatgcttggagtggaagtgtatata
aaaagggatgacctaacgggtttggggatcggtggtaataaagttagaaaactagaatac
ctgctcggagatgcccttgcaaaaggagctgatgttgtaataacaatgggggccgtacac
tctaatcatgcttttgttaccgcccttgctgccaaaaagcttgggcttgatgctgtgttg
gtattaagggggaaggaagttcttaggggcaactacctcctcgataagctcatgggagta
gagactagaatatatgaagctgaaaattcatttgagctgatgaaatatgcggaagaggtt
gcggaagagcttcgggagcagggtaagaggccctacataataccagttgggggagcctct
ccaataggaaccttgggctacgttagagcggttggggagatcgccacacaatctgcagtt
ctcgggctggagtttgatactatagttgatgccgttgggagtggtggaacgatagctggc
ctggcattaggcttggcattggctgggatgaaaaccaggcctgtcggaatggcagtgggg
ttatttggagagaaaatggttcagagaattgaagatttgcttagagaaacttcagaattg
ttaggagtcaaggttaaagttgaggttccggagatatatgattacagctttggtgcatat
ggaaagatagtgagggaagtttccgaaattataaggttagttgggacgaaggagggaata
ctcttggatcctgtttacactggaaaggcattctacgggctaattgaccgggcaaagaag
ggtgaccttggagagaagatactttttgtccatacaggaggaatctctggcttgttccac
tatggcgaggacatgcttaagctccttggtaaggtttga

DBGET integrated database retrieval system