KEGG   Pyrococcus sp. ST04: Py04_0182Help
Entry
Py04_0182         CDS       T02124                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pys  Pyrococcus sp. ST04
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pys00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175545..176405
Genome map
AA seq 286 aa AA seqDB search
MLLHTYRSFDMELPTVDLEKADYIILGLPYDGTTSYKPGARFGPVLIRQATLNFESYLLD
YNVDLAELKIADAGDVALPVDVEKALKIARETIEEMKRINQKALPIFLGGEHSMTLAPVE
ALRPKSYVVFDAHLDLRDEYQGSKFNHACVARRISELGIKTAIFGVRSGTREETKYAEEK
GIEWVHARDYSFEAFVDLVLSMPEPVYVSIDIDVFDASLVPETGTPEPGGLSFWDVVEAL
EWITERKEIVGIDIMEVSGDRLGNLTALTGAKLLFHILGMLAEVKK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctactccacacatacagatcattcgacatggagctaccaacagtagacctagaaaaa
gccgattacataatcctaggactaccctacgacggcacaacaagctacaagccaggagca
agattcggacctgtactcataagacaggccacactcaacttcgaaagctatcttctagac
tacaatgtggatcttgcagagcttaagattgccgatgctggagacgttgcccttccagta
gacgtcgaaaaggccctgaaaatagcaagagagactattgaagaaatgaagagaataaac
caaaaagctctcccaatattcctcggaggagaacattcgatgaccctcgcacccgttgaa
gcactaaggccaaagagctacgtcgttttcgatgcccacttagacctgagggatgaatac
caaggctcaaagtttaaccacgcatgcgtcgcaaggagaattagcgaactcggtataaaa
acagcaatttttggagtaagaagcgggacaagagaagaaacaaaatacgccgaagaaaag
ggcatagaatgggttcacgctcgagactacagcttcgaagcctttgttgacctcgtactc
tcgatgccagaaccagtatatgtatcaattgacatagacgtctttgatgcatcactcgtt
ccagaaaccggaaccccagagcctggtggactgtcattctgggatgtagttgaggccctc
gaatggataaccgagagaaaggagatagttggaattgatattatggaagtatcaggagac
agattagggaacttaacagcactcacaggtgccaaactgctcttccacatcctcggcatg
ctcgcggaggtaaagaaatga

DBGET integrated database retrieval system