KEGG   Pyrococcus sp. ST04: Py04_0262Help
Entry
Py04_0262         CDS       T02124                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pys  Pyrococcus sp. ST04
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Py04_0262
Enzymes [BR:pys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Py04_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
258656..259222
Genome map
AA seq 188 aa AA seqDB search
MRNIKLKLVYYSKLAHKKGLTGSFGGNISVRMGKYVFIKATGGIMEELTPEQIATITING
DVISPIRPSSEYRLHIGVYRNRHDVNAVVHLHPPYAITLSMFEKEAPMLTPEAELYLRKV
PVLPFRPAGSVELAEQVSEAIKNYDAVILERHGIVTVGRSLREAFYKAELVEEISRLWYQ
RFIVEREG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacatcaagcttaagctcgtttattactcgaaacttgcccataagaaggggctt
actggatcatttggaggaaacataagcgttaggatgggaaagtacgtgttcataaaggcg
accggcgggattatggaggaactcactcccgagcaaattgcaactatcacaattaatgga
gacgttatctctccaataaggccatcatcagagtatagattgcacattggggtttacagg
aataggcatgacgtaaatgccgttgtccaccttcaccctccatatgctattactctctca
atgtttgaaaaggaggcccctatgttaactccagaagctgagctctatctcaggaaagtt
cctgttctcccttttagacctgctgggagtgttgaacttgctgaacaggtttctgaggcc
ataaaaaattatgatgcagtcatactggagaggcatggaattgtgacggttggaaggagc
cttagggaagccttttacaaagcggagttagttgaggagatttcaagactatggtaccaa
agatttatagtagagagggaaggttaa

DBGET integrated database retrieval system