KEGG   Pyrococcus sp. ST04: Py04_0484Help
Entry
Py04_0484         CDS       T02124                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00040  Pentose and glucuronate interconversions
pys00052  Galactose metabolism
pys00500  Starch and sucrose metabolism
pys00520  Amino sugar and nucleotide sugar metabolism
pys01100  Metabolic pathways
pys01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Py04_0484
   00052 Galactose metabolism
    Py04_0484
   00500 Starch and sucrose metabolism
    Py04_0484
   00520 Amino sugar and nucleotide sugar metabolism
    Py04_0484
Enzymes [BR:pys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Py04_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFK22086
UniProt: I3RCX6
Position
complement(496133..496732)
Genome map
AA seq 199 aa AA seqDB search
MVDIYYVRQKRPLGLGDAILHAEKHVNGEPFAVLLGDDIIIAEKPAIGQLMEVAEEKNAP
VIGVEKIPWERVSRYGIVKGKEIGKYLYKVEDLVEKPLPEEAPSNIAIIGRYILPPDIFD
ALRETPPGKDGEIQLTDALRLLLKDRDLLAKRIEGKRYDVGDKVGFIIANVELGLLRGDV
RKPILEYLKRLTLGESKNE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtggacatatactacgtgaggcagaagaggccgctggggttaggagatgcgatatta
cacgcggagaagcacgttaacggagagccgttcgccgtgctacttggcgatgacatcata
atagccgagaagccggccataggacaactcatggaagttgcggaggagaagaacgccccc
gttataggcgttgagaagatcccgtgggagagggtaagcaggtacgggatagtaaagggt
aaggaaatcggaaaatacctctacaaggtggaggatctcgtagagaagcctctccccgag
gaagcccccagcaacatcgcaataatcggaaggtatatcctgcctccagacatctttgat
gcattgagagaaacacctccaggaaaagacggggagatacagctcacagatgccctcagg
ctcttactgaaagatagggatcttcttgcgaagagaattgaaggaaagaggtacgatgtt
ggcgataaagtgggattcataatagccaacgttgagctaggtttgttgaggggggacgtt
cgtaaacctattctggagtacttaaaaagactaacattaggagagagcaaaaatgagtag

DBGET integrated database retrieval system