KEGG   Pyrococcus sp. ST04: Py04_0484Help
Entry
Py04_0484         CDS       T02124                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pys  Pyrococcus sp. ST04
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Py04_0484
   00052 Galactose metabolism
    Py04_0484
   00500 Starch and sucrose metabolism
    Py04_0484
   00520 Amino sugar and nucleotide sugar metabolism
    Py04_0484
Enzymes [BR:pys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Py04_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(496133..496732)
Genome map
AA seq 199 aa AA seqDB search
MVDIYYVRQKRPLGLGDAILHAEKHVNGEPFAVLLGDDIIIAEKPAIGQLMEVAEEKNAP
VIGVEKIPWERVSRYGIVKGKEIGKYLYKVEDLVEKPLPEEAPSNIAIIGRYILPPDIFD
ALRETPPGKDGEIQLTDALRLLLKDRDLLAKRIEGKRYDVGDKVGFIIANVELGLLRGDV
RKPILEYLKRLTLGESKNE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtggacatatactacgtgaggcagaagaggccgctggggttaggagatgcgatatta
cacgcggagaagcacgttaacggagagccgttcgccgtgctacttggcgatgacatcata
atagccgagaagccggccataggacaactcatggaagttgcggaggagaagaacgccccc
gttataggcgttgagaagatcccgtgggagagggtaagcaggtacgggatagtaaagggt
aaggaaatcggaaaatacctctacaaggtggaggatctcgtagagaagcctctccccgag
gaagcccccagcaacatcgcaataatcggaaggtatatcctgcctccagacatctttgat
gcattgagagaaacacctccaggaaaagacggggagatacagctcacagatgccctcagg
ctcttactgaaagatagggatcttcttgcgaagagaattgaaggaaagaggtacgatgtt
ggcgataaagtgggattcataatagccaacgttgagctaggtttgttgaggggggacgtt
cgtaaacctattctggagtacttaaaaagactaacattaggagagagcaaaaatgagtag

DBGET integrated database retrieval system