KEGG   Pyrococcus sp. ST04: Py04_0557Help
Entry
Py04_0557         CDS       T02124                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pys  Pyrococcus sp. ST04
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Py04_0557
Enzymes [BR:pys01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Py04_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574561..576915
Genome map
AA seq 784 aa AA seqDB search
MRVTHNGKVYVIDGEEVVIYGGTLQFFRVPRDVWKDRLEKMKSHGLNTVDTYVAWNWHEP
EEGNFDFTGETHPQRDLVGFLELAQELGLYVIIRPGPYICGEWKNGGIPQWLINKHPEIL
AKGPEGSLPNDIYYPPITYLHPTYLEYVMRWYDRVFPIIKDYLYTNGGPIINITIDDEPS
YWETIFQAFLTDYNDIIVKENGVWHQWLRENFSIDQLEDRYKVKISDYVEVEPPKSFSEP
LPKIIDWHHFKVWMINEYVKRLYEKIREYVDVPISILDPYLLLAAWRHFYNYVKKNSLDI
HLWTEFWYSFYRSFDFKEDRLGHIYYKTGIYRNYIRKLRTPPLSIETQTSLANVIEPDEA
ELLYGLLPSLGIHNINYYLYVGGENPRGYESHNGVTWDVYSPISLDGKERQHVEPIKWIG
EFLKSNKEFVYAPFQAEVAFGTYEPYEPLNLWGYRPENFKETVNLDEYLYGERGLLTLLA
MSNVVFDVIDLENATVEEMLNYKQLWVYSLDFMAREVQDKLVEYVERGGNLVIMPMLPYL
DENMNEYRRLEEFLGVKVEEKSARDNFRLIPFVSIDAEGIDRMITRNVAREVRGGTPIAW
ANGKPVAALVRKGKGSAIILGFRLQYFSSYHDMHRKFVDKLLKLQGVERRFEVTDRDMIV
IPRGNYLALINPRGHRVFGKIKYRGIEMPKLLEGIEMKTRGVLFLPVGVRYGRFEVVYST
ATVVGSDGDSISFRNHLSNKSEVALRGVNSVEIKGGRIIEEKIDGDTRIIAVEHGDKEFT
LLLR
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgagggttactcacaatggaaaggtatacgttattgatggcgaggaagttgtcatctat
gggggaactcttcaattctttagagttcccagggatgtttggaaggatagattagagaaa
atgaagtcacatggcctaaataccgttgatacgtatgtagcatggaactggcatgaacct
gaagagggcaacttcgacttcacaggtgaaacgcatcctcagagagatctagtagggttc
cttgaactggcacaggaattggggttatacgtaataataaggcctgggccatatatatgt
ggtgaatggaaaaatggaggcattcctcagtggctgatcaacaaacatccagaaatactc
gccaaaggtcctgaaggttctctgcccaacgatatatactatccacctataacgtatctc
catcctacctatctcgaatatgtaatgagatggtacgatagggttttcccaataataaag
gattacctctacacgaatggggggccgataataaatattacaattgatgacgagccatca
tattgggaaacgatatttcaggctttcctaactgactataatgacattatagttaaggaa
aatggcgtttggcatcagtggcttagggagaacttcagcatagatcagcttgaggacagg
tacaaggttaaaatttcagactatgttgaagttgaacctcccaagagcttctcagaacct
ctaccgaaaataatcgattggcaccactttaaggtatggatgataaatgaatatgttaag
agactttatgagaaaattagggagtacgttgatgtaccaatcagtatacttgatccttac
ctcctcctagctgcctggaggcacttctacaactatgtgaagaagaactccttggacatc
catctctggaccgagttctggtactcattctacaggagctttgactttaaagaggacaga
cttggtcatatctactacaaaacaggaatatacaggaactacataaggaaacttaggact
cctcctttgagcattgaaactcaaacatctctggccaacgtgatagagcctgatgaggct
gagttattatatggcctgttgccttccctcggaatacataatataaattattatctatac
gttggtggagagaatccaaggggttatgagtcacataatggagtaacctgggatgtgtac
tcaccgataagcttagatggaaaggagaggcagcatgttgagcctataaagtggattgga
gagttccttaagagcaacaaagagttcgtttacgccccgttccaggcagaagttgccttt
ggaacttatgaaccctatgaaccgctgaacctttgggggtataggccagaaaacttcaag
gaaaccgttaacttggacgagtacctttatggagaaagggggctcttgacgttactagct
atgagcaatgttgtatttgacgtgatagaccttgaaaatgcgacagttgaggaaatgctt
aactacaagcaactttgggtttacagcctagacttcatggccagggaagttcaggacaag
ctcgtggagtacgtggaaagaggtgggaacctagtcataatgcccatgcttccttactta
gatgagaacatgaatgagtacagaaggcttgaggagttcctaggagtcaaagtagaagag
aaatctgccagagataatttcaggctgatacccttcgtaagcatcgatgctgagggaatt
gacaggatgataactaggaatgttgcgagagaggtgcgtggtggaactccaattgcttgg
gccaatgggaagccagttgctgctctagtcaggaagggtaagggctcggcaataatcctt
ggcttcaggcttcagtacttttcaagctatcatgatatgcacagaaagtttgttgataag
ttgcttaagcttcagggagttgagaggagatttgaggtcacggatagggatatgatagtc
attccgaggggtaattatcttgcattgataaatccaaggggccacagagtctttgggaag
ataaagtacaggggaatagaaatgccaaagctacttgagggcattgagatgaagactaga
ggagttctattcctgccagtgggtgtaaggtatggacgctttgaagtcgtttactcaacg
gcaactgttgtgggaagtgatggggatagcataagctttaggaaccacctgagcaacaag
agcgaggttgccctaagaggtgttaactcggttgagattaagggaggcagaataatcgag
gagaagatcgatggagatactaggataattgcagttgaacacggagacaaggagttcact
cttctccttcgctag

DBGET integrated database retrieval system