KEGG   Pyrococcus sp. ST04: Py04_0719Help
Entry
Py04_0719         CDS       T02124                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Py04_0719
   01230 Biosynthesis of amino acids
    Py04_0719
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Py04_0719
   00030 Pentose phosphate pathway
    Py04_0719
   00051 Fructose and mannose metabolism
    Py04_0719
  Energy metabolism
   00680 Methane metabolism
    Py04_0719
Enzymes [BR:pys01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Py04_0719
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Py04_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(731393..732520)
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITISVIKADVGGWPGHSRVHPALIEKAKEVLSEAQKAGTLIDFYVTYAGDDLQL
IMTHKKGVDNSEIHGLAWEAFKKATEVAKELGLYGAGQDLLKDAFSGNVRGLGPSVAEME
ITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEIWDILEHK
KVIMNSPEEMYDILALIGAKSRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEVAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVPLKYATPTRFDGPPRA
VALGWQISPEGKLIGPVDLFDDPAFEWARQKALEITDYMRRHGPFEPHRLPLEEMEYTTL
PGVLEKLKDRFEPIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaggagagaagataaccattagcgttataaaagcggatgtcggtggctggcca
ggccactccagagtccacccagccttaatcgagaaggctaaggaggttcttagcgaagct
caaaaggcaggaacgcttatagacttctacgtaacgtatgctggagatgaccttcagctc
ataatgactcataagaaaggagtagacaactcagaaatacacggtcttgcatgggaagcc
tttaagaaggcaaccgaagttgccaaagagctcggcctgtatggagcaggccaagaccta
ctcaaggacgcattcagcggaaacgtcaggggactcggtccaagcgttgcggagatggaa
ataactctaagaaagagtgagccaatagttacattccacctcgacaagacagagcctgga
gcattcaacctgccaatcttcagaatgttcgcagacccattcaacactgcaggactcgtt
attgatccaaagatgcacatgggattcaggtttgagatatgggacatattagagcacaag
aaggtaataatgaactcaccggaagaaatgtacgacatcctagccctaatcggagcaaag
tctaggtacgttataaagagagtctatccaaaagagggccacccaattccaaaggatgag
ccagttgcagttgtttcaacagaaaagctctatgaagttgcaggagaatacgtgggtaag
gacgatcccgtggcaatagttagagcccagagtggactacctgcattgggtgaagttctg
gagccctttgcattcccacacctagtgagtggatggatgagaggctcgcacaacggacca
ctaatgccagttccactcaagtacgcgaccccaacaaggtttgacggcccaccaagagct
gtagccctaggatggcagataagcccagaaggaaagctcataggtccagttgacttgttc
gatgacccagcattcgagtgggcaagacaaaaggccctcgagatcactgattacatgagg
agacacgggccattcgagccacacaggctacctcttgaggagatggagtacactacacta
ccaggagttctagagaaacttaaggatagatttgagcccatagagtga

DBGET integrated database retrieval system