KEGG   Pyrococcus sp. ST04: Py04_0743Help
Entry
Py04_0743         CDS       T02124                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pys  Pyrococcus sp. ST04
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Py04_0743
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Py04_0743
Enzymes [BR:pys01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Py04_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(753893..754819)
Genome map
AA seq 308 aa AA seqDB search
MDWTGRDVISIRDFSKEDIEFVLATAERLEKELKEKGQLEYARGKILATLFFEPSTRTRL
SFESAMHRLGGSVIGFAEASTSSVKKGESLRDTIKTVEQYSDVIVIRHPKEGAARLAAEV
ADIPVINAGDGSNQHPTQTLLDLYTIKKEFGKIDGLKIGLLGDLKYGRTVHSLAEALAFY
EVELYLISPEMLRMPRHIVEELKEKGVKVYETSDLESVIKELDVLYVTRIQKERFPDEQE
YLKVKGSYQVNCKILEGVKDNLRIMHPLPRVDEIHPEVDKTKHAIYFKQVFNGVPIRMAL
LGLVLGVL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggactggacaggtagagatgtcataagtattagagacttttctaaagaagatatagag
ttcgtccttgcaactgccgaaaggcttgaaaaggaacttaaagagaaggggcagctggag
tatgcgagaggaaaaatcctcgcaacactattttttgagccctcaactagaacaaggcta
agctttgaatccgccatgcacaggctgggaggtagtgttatagggtttgcggaagcatca
actagtagcgttaagaagggtgagagccttagagatacaataaaaacagtcgaacagtat
agtgacgtcatagtgattagacatccaaaagaaggggctgcaaggcttgccgctgaagtt
gcagacattccggtcataaatgcgggggatggaagtaatcaacatccaacacaaactctc
ctcgacctatatacaataaagaaagagtttggaaaaattgatggcctgaaaattggactc
cttggtgacttaaagtatggaagaacagttcatagcttagctgaagcacttgcattctat
gaggtagagctttatcttatctctccagagatgctaaggatgccaagacatatagttgaa
gagctaaaggagaaaggagttaaagtctatgaaacatcagacctagaatctgtaataaaa
gagctcgacgtcttgtacgtcactagaattcaaaaagaaaggtttcctgatgagcaagag
tatctcaaggtgaagggcagctatcaagtgaactgtaaaattttggagggtgtcaaagac
aacctaaggataatgcatccactccctagggtcgatgaaatacatcccgaggtagacaag
acgaaacatgctatatatttcaaacaggtttttaatggtgttccaattagaatggctctc
cttggccttgttctgggggtgttgtga

DBGET integrated database retrieval system