KEGG   Pyrococcus sp. ST04: Py04_0787Help
Entry
Py04_0787         CDS       T02124                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pys  Pyrococcus sp. ST04
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Py04_0787
Enzymes [BR:pys01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Py04_0787
    3.5.1.-  
     Py04_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798141..798680
Genome map
AA seq 179 aa AA seqDB search
MEALIVVDMQRDFMPGGALPVPDGDKIIPKVNEYIKKFKEKGALIVATRDWHPENHISFK
ERGGPWPRHCVQNTQGAEFVVDLPEDAIIISKATDPDKEAYSGFEGTNLAEILKEKGVKR
VYICGVATEYCVRATALDALKYGFEVYLLKDAVKGITPEGEEKALKEMEEKGVKIVENL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaggccctgatagttgttgacatgcagagggatttcatgccgggaggagcactacct
gttcccgatggggataaaattattccgaaagtaaacgaatacataaagaaattcaaagag
aaaggggctctgatagttgctacaagggattggcatcctgaaaatcatataagcttcaaa
gaaaggggaggcccgtggccaaggcactgtgttcaaaatacacagggagctgagttcgtt
gtagacctgccggaagatgccataataatatctaaggcaacagatccggataaagaggca
tattctggctttgaaggtactaatttggcggagatactaaaagagaagggggtaaagagg
gtatacatctgtggtgtcgcaacggagtactgcgttagagccactgcactcgatgcatta
aagtacggctttgaggtttaccttctcaaagatgctgttaaggggataacaccagaagga
gaagaaaaggccctcaaagaaatggaggaaaaaggagttaagattgttgagaacttgtaa

DBGET integrated database retrieval system