KEGG   Pyrococcus sp. ST04: Py04_0858Help
Entry
Py04_0858         CDS       T02124                                 

Definition
phospho-sugar mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Py04_0858
   00030 Pentose phosphate pathway
    Py04_0858
   00051 Fructose and mannose metabolism
    Py04_0858
   00052 Galactose metabolism
    Py04_0858
   00500 Starch and sucrose metabolism
    Py04_0858
   00520 Amino sugar and nucleotide sugar metabolism
    Py04_0858
  Nucleotide metabolism
   00230 Purine metabolism
    Py04_0858
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Py04_0858
Enzymes [BR:pys01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Py04_0858
    5.4.2.8  phosphomannomutase
     Py04_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
865539..866909
Genome map
AA seq 456 aa AA seqDB search
MGKLFGTFGVRGIANEKITPEFAMKIGMAFGTMLKREGRKKPVVVVGRDTRVSGEMLKNA
LISGLLSVGCDVIDVGIAPTPAVQWATKYFNADGGAVITASHNPPEYNGIKLLEPNGMGL
KKEREAIVEELFFKEDFDRAKWYEIGEVRREDIIKPYIEAIKSKVDVEAIKKRRPFVVVD
TSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLRGFMEIVKALGADFGV
AQDGDADRAVFIDEKGRFIQGDKTFALVADAVLRENGGGLLVTTVATSNLLDDIAKRNNA
KVLRTKVGDLIVARALLEHNGTIGGEENGGVIFPDHVLGRDGAMTVAKIVEIFAKSGKKF
SELIDELPEYYQIKTKRHVEGDRYKIVNKVAEMAKERGYTVDTTDGAKIIFEDGWVLVRA
SGTEPIIRIFSEAKSEEKAEEYLNLGLELLEKALEA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggggaagctctttggaacgtttggagtgagggggatagcaaacgaaaagataacccca
gaattcgccatgaagattgggatggcatttgggacaatgctaaaaagagagggaaggaaa
aagccggtagtggttgttggtagagatacaagagtcagtggggaaatgctcaaaaatgcc
ttgataagtggcctcctcagcgttggctgtgatgtaatagatgttggcatagctcccaca
ccggcagttcaatgggcaaccaaatatttcaacgcagacggtggagctgttatcacggcc
tctcataatcctccggagtacaacggaataaagcttttggaacctaatgggatggggctg
aagaaagagagggaagcaattgttgaggaactcttctttaaagaagacttcgatagggct
aagtggtatgaaattggagaagttagaagagaggacataataaagccctatatcgaggct
ataaagagcaaagtcgatgttgaagcgataaagaaaagaagaccctttgtggttgttgac
acgtctaacggtgctggaagcttgactctaccctatctgctcagagaacttggatgtaaa
gttgtgagcgttaacgctcacccagatggacatttcccagcaagaaatcctgaaccgaat
gaagaaaacttgagaggatttatggagatcgttaaggcgcttggagccgactttggagtg
gcccaggacggagatgcagatagggcagttttcattgatgaaaagggcaggtttatccaa
ggggataaaacatttgccttggttgcagatgctgttctcagagaaaatggagggggtctt
ctggtaactacagttgctacctctaaccttcttgacgacatagctaaaagaaacaatgcg
aaagttctcagaactaaggttggagatctaatcgttgcaagggctcttcttgagcacaac
gggaccataggaggtgaagaaaacggtggagtaatattcccagaccatgttcttggaagg
gatggagcaatgaccgtggcaaagatagttgagatattcgcaaagagcgggaagaagttc
agtgagcttatagatgagttgcctgaatattatcaaataaagaccaagaggcatgtagag
ggggacaggtacaaaattgtcaacaaagttgctgaaatggcaaaagagagaggttatact
gtagatactactgatggtgcaaagataatattcgaagatgggtgggttctggttagggca
agtggaactgagccaataataagaatattcagcgaagcaaagagcgaggaaaaggcggaa
gagtatctaaacttaggattagagcttcttgaaaaagccctagaggcctga

DBGET integrated database retrieval system