KEGG   Pyrococcus sp. ST04: Py04_0868Help
Entry
Py04_0868         CDS       T02124                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pys  Pyrococcus sp. ST04
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pys01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pys00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(877040..878728)
Genome map
AA seq 562 aa AA seqDB search
MDPKVDPFSPENKLIFATGPLTGTSAPTGGRYMVITKSPLTGYIAMANSGGYFGAELKFA
GWDAIIIEGKADHPVYLYINEENVEIRDASHVWGKVVSETEAKLKEEVGDKNVQIASIGP
AGENKVRFAAVMNNGHRAAGRGGVGAVMGSKNLKAIVVRGRKRVEIADKGKFMEVVREKI
EKLRNDPVAGGGLPKYGTAVLVNIINENGLYPTRNFQTGVFKYAYEQSGEAMAAKYLIRN
KPCFACPIGCGRVNKLPTLGETEGPEYESTWALGANLGINDLASIIEANHLADEYGMDTI
SLGGTLATAMELYERGLLKQEDIGGDNVPPFRFGNTEVLHYWIEKIAKREGFGDILAEGG
YRLAEKFNGLEYFMGVKKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPY
KMDPHDISDEKVKMVILFQDLTALIDAAGLCLFTTFGLGADDYRDMLNAALGWDFSTDDY
LKIGERIWNAERLFNLKAGLDPLKEDTLPKRLLEEPMPEGPHKGHVVRLKEMLPRYYKFR
GWTEDGRIPEEKLKELGLEEFI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatccaaaggttgatccatttagccccgaaaataagttaatctttgccacaggccca
ctaacaggaacctcagctccaaccggtggaagatatatggttataactaaaagcccacta
accggttatattgctatggctaattccggcggatactttggggctgaattaaagttcgcc
ggttgggatgcaataatcatcgaaggaaaggcagatcatcccgtgtatctctatataaac
gaggaaaatgttgagattagagatgcctcccatgtgtggggtaaagttgtaagcgaaact
gaagcaaagctaaaggaagaagttggcgacaaaaacgtccaaatagcatcaatagggcca
gcaggtgaaaataaggtaagatttgcagcagtaatgaacaatggacacagagccgctgga
agaggtggagttggagcagtaatgggaagcaagaatcttaaggcaatcgtagttagggga
aggaagagggtcgagattgcagataaaggtaagtttatggaagtagttagggagaaaatc
gaaaaattaagaaatgatcctgtcgccggaggaggccttccaaagtacggaaccgctgtt
ttggttaacataataaatgaaaatggactctatccaacaagaaacttccaaacgggagtg
tttaagtatgcctatgaacagagcggtgaagctatggcggcaaaatacctaataaggaat
aaaccatgctttgcatgtccaattggatgtggaagagtgaacaaacttccaaccctcgga
gaaactgaaggacctgagtatgagagcacttgggcactcggtgcaaatctaggaattaac
gacctcgcatctatcatagaagcaaaccaccttgcagacgagtatggaatggatacgata
agccttggtggaacactagctactgcaatggaactttatgagagaggcctactaaaacaa
gaggacataggaggggataacgtcccacctttcagatttggaaacacggaagtcctacac
tactggatcgagaaaattgctaagagagaaggattcggagatattctggcggaaggagga
tataggctagctgaaaagttcaacgggctcgaatacttcatgggagttaaaaagcaagag
cttccggcatacgacccaagaggtgcagagggacacgggcttggatatgcaactaacaac
agaggtggttgtcacatcaagcagtacatgataagtccagagatccttggttatccgtac
aagatggatccacacgacataagcgacgagaaagtcaaaatggtaatactgttccaggac
ctaacggccctaattgatgccgccggactatgtctatttacgacgtttggacttggagct
gacgactacagagacatgctaaacgcagcactcggatgggacttctctacagatgactac
ctcaagattggagagaggatctggaatgcagagaggttgtttaaccttaaggcaggccta
gatccacttaaagaggacacactaccaaagaggctactcgaagagccaatgcctgaaggt
cctcacaagggccacgtggttaggctcaaggaaatgctaccaaggtactacaagttcaga
ggctggacagaagatggaagaattccagaagaaaagctcaaagaacttggacttgaggag
ttcatctga

DBGET integrated database retrieval system