KEGG   Pyrococcus sp. ST04: Py04_1007Help
Entry
Py04_1007         CDS       T02124                                 

Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Py04_1007
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Py04_1007
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Py04_1007
Enzymes [BR:pys01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Py04_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1025534..1026718
Genome map
AA seq 394 aa AA seqDB search
MVLRCIRCGREYPEDEVRYRCECGGLLEVVIDLDKVDTNIFDGKNVTLWKYESWLPVKKR
VTLNEGGTPLYKLENLGKDLGIRELYAKNEGANPTGSFKDRGMTVGVSKALELGMDKVIC
ASTGNTSASLAAYAAKAGIKAYVLVPSGKIALGKLAQAIIYGAQVVPVKGNFDDALRIVV
EASSKLGVYMLNSINPFRLEGQKTIAYEIYDQLQEVPDNVVLPVGNAGNISAIWKGFKEL
YEAGVIDKLPRMIGIQAEGASPLAKAWKEKREFRPEERPETVATAIRIGNPANWPKAWKA
VEESGGTFESVSDKEILEAQRLLASREGLFVEPASAASLAGLIKLLKNGEIEKDESYVLI
TTGHGLKDPNIVIDNFRLPEPIEPTLEAFRRVMK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggttttgagatgcattaggtgtggtagggaataccccgaggatgaggtaaggtacagg
tgcgagtgcggaggattgctagaggttgtaatagacttggacaaagttgatactaacata
tttgacggcaaaaatgtaaccttgtggaagtatgagagctggctccccgttaagaaaagg
gtaaccttgaatgaggggggaacacctctctacaagcttgaaaacctcggaaaggatttg
gggatcagggagctctatgcaaaaaatgaaggggcaaatccaactggttcctttaaagat
agaggaatgactgtcggggtttcaaaggcattggagcttggaatggataaagttatatgt
gcgtcaacagggaatacctctgcatccctggctgcatacgcggcaaaggctggaataaaa
gcatatgttcttgtaccgagtgggaagatagccctcggaaaacttgcacaggcaataata
tacggagcccaggtagttcccgtcaagggtaactttgacgatgctctcagaatagttgtt
gaggccagctcaaagcttggggtttacatgttgaactctataaaccccttcagactcgaa
ggacagaagactatagcatatgaaatttatgaccagcttcaggaggttcccgacaacgtt
gtcctcccagtaggaaacgctggaaacatttcagcaatatggaagggcttcaaggagctt
tacgaggctggagtaatcgacaagttgcccaggatgataggtatccaggcagaaggggct
tctcctttagcgaaagcatggaaggagaagagagagttcagaccagaagaaaggccagaa
actgttgccactgctataagaataggaaatccagcaaattggccaaaggcgtggaaggct
gttgaagagtcgggaggaacctttgagagtgtaagcgataaggaaattttagaggctcag
agacttttggcttcaagagagggactctttgtcgagccagcttctgcagcatctctggct
ggcttaattaagctccttaagaatggagaaatagagaaagatgagagctacgttctcata
actacaggtcacggactaaaagacccgaatatagttatcgacaactttaggcttcctgaa
ccgatagagccaaccttagaggcatttaggagggttatgaaatga

DBGET integrated database retrieval system