KEGG   Pyrococcus sp. ST04: Py04_1033Help
Entry
Py04_1033         CDS       T02124                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pys  Pyrococcus sp. ST04
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pys00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046981..1048438
Genome map
AA seq 485 aa AA seqDB search
MCLIAGGLSLSSKDIAKIIETGKHRGPDSFGVWSDGFVLKSSNFGDVDEVKGGEHVLIQC
RLAITGSKSYTQPFYNDIVLVHNGEIYNHEFLREYLVERGVSFETDVDSEVILRLLEYYL
YEKRLSPWEAVKKIMLMLNGDYAVAFLYNGKLYLFRDPIGIRPIYYSQSGRFASEKKVLW
AIGDDAHPVNPGELVEISRSGIVKRRLLRLTSIKSLGSSYKDGLKNLLENSVNLRKRGKI
GVLFSGGLDSSLIALIASRFSKVVLYSAGAEGSRDIEWARKVSEELGLELREFIFTLDDV
KTAIPEVMFAIEEPNPMNLAIGIPLYFATKLAREDGMRVLLSGQGADELFGGYAKYLNNP
TLMIKDFEELAERNLARDDKVSMLNGVEVRYPYLDQAFAVLALNAPINEKIKDGKRKVIL
RKIAIEMGLPEFVANREKKAMQYGSNSQKFLEKIAKSEGVKLRELAALKFREVFGRMRRG
TGAER
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctgatagctggtggactttcactctcatcaaaagatatagccaagataatcgaa
actggtaaacataggggcccagattcatttggtgtttggagtgatggttttgttctaaaa
tccagcaactttggggacgttgatgaagttaagggtggagagcatgtccttattcagtgc
agacttgcaataacggggtcgaaaagttatacacaacctttttacaatgacattgttttg
gtccataacggagagatatacaaccatgaattcctgcgagagtatttggtggaaagggga
gtaagctttgagacagatgttgatagtgaagttatcctgaggttattggagtactatctc
tatgagaagaggttatctccctgggaggctgttaaaaaaattatgctgatgcttaatggt
gattatgccgttgcattcctatataacggaaagctctatcttttcagggatccaattggg
ataaggccgatatactattcccaaagtggtcgctttgcttcagaaaaaaaggtactttgg
gctataggggatgatgcgcatccagtaaatcctggagagcttgttgagatcagcaggagt
ggtatagtaaagagaaggctccttagacttacaagtataaagtctttgggaagctcatat
aaagatggcctgaagaatcttctcgaaaattcagtaaatttaagaaagagaggcaaaatc
ggggttttattctcgggtggtttggacagctccctcatagccttgatagcatcgagattt
tctaaagttgtgctctattcggctggagccgagggtagtagagatatagaatgggcaaga
aaggtatctgaagaactcggactagagcttagagagttcatattcaccctggatgacgtt
aaaacggctattcccgaggtcatgtttgcaatagaagagccaaatcctatgaatttggct
ataggtatccccctgtactttgcaaccaaactagctagggaagatggcatgagggtcttg
ttaagtggtcagggagcagatgagctcttcggggggtatgcaaaatacctcaataaccca
actctcatgattaaagactttgaagagcttgccgagaggaacctggctagagatgataag
gtttcaatgctaaatggagttgaagttagatacccataccttgaccaagcatttgcagtt
cttgccctaaatgcgcccataaatgagaagattaaagatgggaagagaaaagtaatactt
agaaaaatcgcgattgagatgggtcttcctgaatttgttgctaacagggagaagaaggct
atgcagtatggaagtaattctcaaaaattcttagagaaaatagctaagtctgaaggggtt
aagcttagggaacttgctgccctgaaatttagagaggtctttgggcggatgaggagaggg
actggtgctgaaaggtga

DBGET integrated database retrieval system