KEGG   Pyrococcus sp. ST04: Py04_1033Help
Entry
Py04_1033         CDS       T02124                                 

Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00250  Alanine, aspartate and glutamate metabolism
pys01100  Metabolic pathways
pys01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Py04_1033
Enzymes [BR:pys01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Py04_1033
Peptidases [BR:pys01002]
 Cysteine Peptidases
  Family C44
   Py04_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AFK22608
UniProt: I3REE8
Position
1046981..1048438
Genome map
AA seq 485 aa AA seqDB search
MCLIAGGLSLSSKDIAKIIETGKHRGPDSFGVWSDGFVLKSSNFGDVDEVKGGEHVLIQC
RLAITGSKSYTQPFYNDIVLVHNGEIYNHEFLREYLVERGVSFETDVDSEVILRLLEYYL
YEKRLSPWEAVKKIMLMLNGDYAVAFLYNGKLYLFRDPIGIRPIYYSQSGRFASEKKVLW
AIGDDAHPVNPGELVEISRSGIVKRRLLRLTSIKSLGSSYKDGLKNLLENSVNLRKRGKI
GVLFSGGLDSSLIALIASRFSKVVLYSAGAEGSRDIEWARKVSEELGLELREFIFTLDDV
KTAIPEVMFAIEEPNPMNLAIGIPLYFATKLAREDGMRVLLSGQGADELFGGYAKYLNNP
TLMIKDFEELAERNLARDDKVSMLNGVEVRYPYLDQAFAVLALNAPINEKIKDGKRKVIL
RKIAIEMGLPEFVANREKKAMQYGSNSQKFLEKIAKSEGVKLRELAALKFREVFGRMRRG
TGAER
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctgatagctggtggactttcactctcatcaaaagatatagccaagataatcgaa
actggtaaacataggggcccagattcatttggtgtttggagtgatggttttgttctaaaa
tccagcaactttggggacgttgatgaagttaagggtggagagcatgtccttattcagtgc
agacttgcaataacggggtcgaaaagttatacacaacctttttacaatgacattgttttg
gtccataacggagagatatacaaccatgaattcctgcgagagtatttggtggaaagggga
gtaagctttgagacagatgttgatagtgaagttatcctgaggttattggagtactatctc
tatgagaagaggttatctccctgggaggctgttaaaaaaattatgctgatgcttaatggt
gattatgccgttgcattcctatataacggaaagctctatcttttcagggatccaattggg
ataaggccgatatactattcccaaagtggtcgctttgcttcagaaaaaaaggtactttgg
gctataggggatgatgcgcatccagtaaatcctggagagcttgttgagatcagcaggagt
ggtatagtaaagagaaggctccttagacttacaagtataaagtctttgggaagctcatat
aaagatggcctgaagaatcttctcgaaaattcagtaaatttaagaaagagaggcaaaatc
ggggttttattctcgggtggtttggacagctccctcatagccttgatagcatcgagattt
tctaaagttgtgctctattcggctggagccgagggtagtagagatatagaatgggcaaga
aaggtatctgaagaactcggactagagcttagagagttcatattcaccctggatgacgtt
aaaacggctattcccgaggtcatgtttgcaatagaagagccaaatcctatgaatttggct
ataggtatccccctgtactttgcaaccaaactagctagggaagatggcatgagggtcttg
ttaagtggtcagggagcagatgagctcttcggggggtatgcaaaatacctcaataaccca
actctcatgattaaagactttgaagagcttgccgagaggaacctggctagagatgataag
gtttcaatgctaaatggagttgaagttagatacccataccttgaccaagcatttgcagtt
cttgccctaaatgcgcccataaatgagaagattaaagatgggaagagaaaagtaatactt
agaaaaatcgcgattgagatgggtcttcctgaatttgttgctaacagggagaagaaggct
atgcagtatggaagtaattctcaaaaattcttagagaaaatagctaagtctgaaggggtt
aagcttagggaacttgctgccctgaaatttagagaggtctttgggcggatgaggagaggg
actggtgctgaaaggtga

DBGET integrated database retrieval system