KEGG   Pyrococcus sp. ST04: Py04_1078Help
Entry
Py04_1078         CDS       T02124                                 

Definition
pyuvate ferredoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Py04_1078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Py04_1078
   00020 Citrate cycle (TCA cycle)
    Py04_1078
   00620 Pyruvate metabolism
    Py04_1078
   00640 Propanoate metabolism
    Py04_1078
   00650 Butanoate metabolism
    Py04_1078
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Py04_1078
   00680 Methane metabolism
    Py04_1078
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Py04_1078
Enzymes [BR:pys01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Py04_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1093068..1093385)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERAQKELTEKMTPGAIVYLPGSSVINKTGSWRVFKPEFNKDKCVRCFLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTNAIEMVREVK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagtccgtttaaggcggatatagaaagggcacaaaaagagctaacagaaaaa
atgacgccgggagcaatagtctatcttcctgggagtagcgtcattaacaagactggttcc
tggagagtttttaagcccgaatttaacaaagacaagtgtgtaaggtgcttcctctgttac
atctactgtccagagcccgcaatatacctcgatgaagaagggtacccagtttttgactac
gactattgtaagggttgtggaatctgcgcaaatgagtgcccaaccaatgctattgaaatg
gttagagaagtgaagtga

DBGET integrated database retrieval system