KEGG   Pyrococcus sp. ST04: Py04_1418Help
Entry
Py04_1418         CDS       T02124                                 

Definition
(GenBank) M42 family glutamyl aminopeptidase, de-blocking aminopeptidase
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pys  Pyrococcus sp. ST04
Brite
Enzymes [BR:pys01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     Py04_1418
Peptidases [BR:pys01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   Py04_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1412485..1413531)
Genome map
AA seq 348 aa AA seqDB search
MVDYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEIKVDRLGNVIAHKKGNGPKVMI
AAHMDQIGLMVTHIEKNGFLRVAPIGGVDPKTLIAQRFKVWVDKGKFIYGVGASVPPHIQ
KPEERKKAPDWDQIFIDIGAESREEAEEMGVRIGTVITWDGRLERLGKHRFVSIAFDDRI
AVYTLIETARQLEDTKADVYFVATVQEEVGLRGARTSAFGINPDYGFAIDVTIAADVPGT
PEHKQVTQLGKGTAIKIMDRSVICHPTIVRWLEELAKKNEIPYQLEILLGGGTDAGAIHL
TREGVPTGAISVPARYIHSNAEVVDERDVDATVKLMVKALENIHELKL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggattatgaacttcttaagaaagtggtggaggcacctggggtttcagggtatgag
ttcctggggataagagatgttgtaatagaagaaatcaaagactatgtggatgagattaag
gttgatagactcggaaacgtgatagctcacaagaaaggaaacggaccgaaagtcatgata
gcagcccatatggatcaaataggtctgatggttacccatatagagaagaatggattcctt
agagttgctcctatcggcggagttgatcctaaaacgttgatagcccaaaggtttaaggtc
tgggttgataaaggaaaattcatctatggtgttggcgcatccgtacctccgcacattcaa
aagcctgaggaaagaaagaaggctcctgactgggatcagatattcatagacattggtgcc
gagagcagagaagaagcagaagaaatgggagttagaataggaaccgtcataacgtgggac
ggcaggcttgagaggcttggaaagcacagatttgtgagcatagcatttgacgataggatt
gctgtttataccttaattgagactgcaagacagcttgaggatacaaaagccgatgtatac
tttgtagcgacggttcaggaagaagttggccttagaggagctagaacttcggcatttgga
ataaacccagactatggctttgcaatcgatgttacaatagctgctgatgtccctggaacg
ccggagcacaagcaggttacccaactcggcaagggaactgcaataaaaattatggatcgc
tctgtgatatgccatccaacgatagtgaggtggcttgaggagctagctaagaagaatgaa
attccctaccagctcgaaatacttctaggtggaggtactgatgctggggcgattcacctt
acaagggaaggagtcccaacaggtgcaatcagtgtccctgccagatacattcactccaac
gccgaggttgttgatgaaagggacgtggatgccaccgttaagttgatggtcaaagcctta
gagaacattcatgagctgaagctttag

DBGET integrated database retrieval system