KEGG   Pyrococcus sp. ST04: Py04_1470Help
Entry
Py04_1470         CDS       T02124                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Py04_1470
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Py04_1470
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Py04_1470
Enzymes [BR:pys01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Py04_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1458782..1460119
Genome map
AA seq 445 aa AA seqDB search
MKVVLPDGKIPRRWYNILPDLPEPLAPPLDPETNEPIDPEKLKRIFAEELVKQEMSTERY
IEIPKEVRELYAKIGRPTPLFRATNLEKILDTPARIYFKYEGATVTGSHKINTALAQAYY
AKKQGIERLVTETGAGQWGTALSLAGALIGLKIRVYMARASYYQKPYRKTLMRIYGAEIY
PSPSENTEVGRKFLKEDPNHPGSLGIAISEAIEDVLKDDKARYSLGSVLNHVLMHQTVIG
LEAKEQMKEFEEPDIIIGCVGGGSNFAGLAYPFVKDVLDGKSEYEFIAVEPRAAPSMTRG
VYTYDYGDSGRLTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSILINHGIVKPIAYHQ
TEVFEAATLFAKAEGIVPAPESAHAVKAAIDKALEAKKEGKEVVILFNLSGHGLLDLKGY
EDFLDGKLEDYEPEEFPILKEVSKS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagttctcccagatggtaaaatacccaggagatggtacaatatacttcccgac
cttccagagccactagcccctccgctagacccagagacgaatgagccaatagacccagag
aaactgaagaggatttttgcagaagagttagttaagcaagaaatgagcactgaaaggtat
atagagatccccaaggaagtgagagagctctatgcaaaaataggaagaccaacaccatta
tttagggctactaacttagagaagattctagatacacccgcaagaatctactttaagtac
gaaggggcaaccgttactggaagtcataaaataaacactgccctcgcacaggcatattat
gcaaagaagcagggaatagaaagattagtgaccgaaactggtgcaggacagtggggaaca
gcattaagtttggctggtgcactcatagggcttaaaattagggtctatatggccagagca
agttactaccagaagccctacagaaagacattgatgaggatttatggagctgagatatac
ccaagtcccagcgaaaacacagaagtcggaaggaagtttttaaaagaggatccaaatcat
cctggtagcttaggaatagcgataagtgaagctatagaggacgttttgaaggatgacaag
gcaagatactcacttggaagtgtgctcaaccacgttttgatgcaccaaaccgtaatcggg
ctagaagcaaaagaacagatgaaagagtttgaagagccagatataataatagggtgtgtt
ggaggagggagtaacttcgcgggtctagcatatcccttcgtaaaggatgtcttagatggg
aaaagtgagtacgaatttatagccgtcgagccaagggcagcaccttcaatgaccagggga
gtctacacatacgattacggagattcagggagactaacaccaaaaatgaaaatgcatacc
ctaggacatacatactacgttccaccaatccatgcaggaggattgagatatcatggccta
gcccccacccttagtatcctaataaaccatggaattgtaaaaccaattgcctatcatcaa
acagaagtgtttgaggctgcaactctatttgcgaaggctgaagggatagttccagcaccc
gaaagtgctcacgccgtcaaggcagcaatagataaagcattagaggcaaaaaaggagggt
aaggaagtcgttattctattcaacctaagtggacatggcttgctcgatttgaagggttac
gaagacttccttgatggtaagcttgaagattatgaaccagaggagtttccaatattaaaa
gaggtctctaaatcttaa

DBGET integrated database retrieval system