KEGG   Pyrococcus sp. ST04: Py04_1485Help
Entry
Py04_1485         CDS       T02124                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pys  Pyrococcus sp. ST04
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Py04_1485
Enzymes [BR:pys01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Py04_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1472063..1473574
Genome map
AA seq 503 aa AA seqDB search
MRGKVKILNLETGHFTIFINPQDAKVWKLHPNDLVRVETGKRSIYGSVVISDFVGEGEVG
LSKDVLSSYQFSEGELVTVTPAGTPESVRYIRKKMRGEKLRKVEIETIVKDIVDRKLRNT
EISAFVTAIEINGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNVIVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVTLSLDEIKRIVEKIGACLVWGGALNLA
PADDLTIHVERRLSLDPRGLMLASIMSKKYAIGSQYVLIDIPTGKGVKVETLEEARSLAK
DFIELGKRLGQYVEVAITYGGQPIGHTIGPALEAKEALETLMTGKGPGSLVEKAIGLAGI
LLEMGGAAPRGMGRKMAREILESGKAYEKMREIIAEQGGDPDIKPEDIQIGDKTYTIYAQ
ASGYVTGIDNKAMTAIAREAGAPEDKGAGIMLHVKVGEKVKEGDPLFTIHAESEGKLDKA
IVLARRLEPIKIEGMVLQVIGNL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagggggaaagtgaaaatactcaacctagagactggacattttacgattttcataaat
cctcaggacgctaaagtctggaaacttcacccaaatgatcttgtaagagtggaaacgggg
aagaggtcaatatatggaagtgtcgtaattagtgattttgttggtgagggcgaggtcgga
ttatcaaaagatgtcttatccagttatcagttttctgaaggagaattagttactgtaacg
ccagcgggaactccagagagcgttagatacattcgtaagaagatgaggggtgaaaagctt
aggaaagttgaaatcgaaacaatagtaaaagatatcgtagatagaaagctcagaaacaca
gaaataagcgcgtttgttactgcaatcgagatcaatggccttgatatggacgagatagca
gccctaacgatagcaatggcagagacgggagatatgcttgacatagacaggaaacccatt
atggacgttcacagtataggtggggttcccggcaacaaaactaacgtaattgtggttcca
atagttgccgcagcaggtttaacgataccaaaaacaagctcaagagcaataacgagcgca
gccggaacggccgatgtcgttgaagtcttgaccaatgttaccttgagccttgatgaaata
aagagaatagttgagaaaataggggcatgtctagtgtggggtggagcactaaatttagct
ccagcagacgatttgacgatccacgttgagagaaggttaagtctcgatccaagaggatta
atgctcgcaagcattatgtccaaaaaatacgctataggaagccaatatgttctcatagat
attcccaccggaaagggggttaaggttgagacattagaagaagcgaggtcactggctaaa
gatttcatagagctggggaagaggctcgggcagtacgttgaggtggcaataacttacgga
ggccagccaattggtcacacaatagggccagcacttgaagccaaagaagccttagaaaca
ctgatgactggtaaaggaccaggaagcctggttgagaaagcaataggactagctggaatc
ctattagagatgggaggagctgctcctagaggaatgggtcgaaaaatggccagggaaatc
ttagaaagtggaaaagcatatgagaagatgagagagataattgcagagcaaggaggagat
ccagacataaagcctgaagatattcaaatcggggataaaacttacacaatatatgctcaa
gcgagcggatatgtaacgggtatagataataaagcaatgactgccatagcaagggaagcc
ggtgctccagaagacaagggggcaggaataatgcttcatgttaaagtgggagaaaaggtc
aaagaaggagatccgctcttcacaatacatgcggagagcgagggtaagctagacaaggca
atagtgcttgcaagaaggctagaacccataaaaattgaaggaatggtgctacaagtgatc
gggaacctttaa

DBGET integrated database retrieval system