KEGG   Pyrococcus sp. ST04: Py04_1609Help
Entry
Py04_1609         CDS       T02124                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Py04_1609
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Py04_1609
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Py04_1609
Enzymes [BR:pys01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Py04_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1583097..1584263
Genome map
AA seq 388 aa AA seqDB search
MWFGRFGGQFVPETLIEPLKELEKAYKKLKNDKEFQEQLDYYLRNWAGRPTPLYYAERLT
KKIGGAKIYLKREDLLHGGAHKTNNAIGQALLAKFMGKSRLIAETGAGQHGVATAMAGSL
LGMKVDIYMGAEDVERQKMNVFRMKLLGANVVPVHSGSKTLKDAINEALRDWVATFEYSH
YLIGSVVGPYPYPIIVRDFQSVIGREAKQQILEAEGTLPDAIVACVGGGSNAMGIFYPFV
GEKRVRLIGVEAGGKGLETGLHSASLNAGEEGVFHGMLSYFLQNDEGQITPTHSIAPGLD
YPGVGPEHAHLKESGRAEYVVVTDEEALRAFHELSRTEGIIPALESAHAVAYAMKLAKEM
DRDEVIIVNLSGRGDKDLDIVLKVSGNV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttggtagatttggtggtcagttcgttcctgaaaccttaattgagcccttaaaa
gaattagagaaggcatataaaaagttgaaaaatgacaaagagttccaagagcaactagac
tactacctaagaaactgggccggaaggccaactcccctatactatgcagagaggctaacc
aaaaaaatcggcggagcaaagatatacctcaagagagaagacctacttcacggcggagct
cacaaaacaaacaatgcaataggtcaagctcttctcgcaaagttcatggggaaaagcaga
ctgatagcagaaactggagccggccagcacggggttgcaaccgcaatggcaggttcactg
cttggaatgaaagtcgacatatacatgggcgcagaagacgtcgaaagacaaaaaatgaac
gtcttcagaatgaaactgcttggagccaacgttgttccagttcactcagggtcaaagacg
ctcaaagatgcaataaacgaagccctaagagattgggtagcaacttttgaatactctcac
tatctcataggctcagtcgttgggccgtatccctatccaataatagttagagattttcag
tcagtaataggaagagaggcaaagcaacagatactcgaagccgagggaactctaccagat
gccatagtcgcctgcgttggaggaggaagtaatgcaatggggatattctacccattcgtt
ggagagaaaagggtgagactgataggggtagaggctggagggaagggactcgaaactggt
ctgcactcagcatcactcaacgccggagaagaaggagtatttcacggaatgctgagctac
ttccttcaaaatgacgagggccaaataacaccaactcacagcatagctcccggcttagac
tatccaggagttggaccggagcatgcgcacttaaaagagagtggcagggcagaatacgtt
gtggttacggatgaagaggcgctaagagcgtttcacgagttgtcaagaactgaagggata
ataccagccctagaatcggcgcatgcagttgcatacgcaatgaaacttgccaaggaaatg
gatagagatgaagtaataatagtaaacttgtctggaagaggagacaaagatctagatatc
gtattaaaggtgagcgggaatgtttaa

DBGET integrated database retrieval system