KEGG   Pyrococcus sp. ST04: Py04_1610Help
Entry
Py04_1610         CDS       T02124                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Py04_1610
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Py04_1610
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Py04_1610
Enzymes [BR:pys01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Py04_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1584256..1585017
Genome map
AA seq 253 aa AA seqDB search
MFKDHSIIPYLTAGDPTVDSTLEFLLAVDEFAGAIELGIPFSDPMADGKTIQESHFRALK
NGFRLEDAFYIIREFRKHSETPLVIMTYYNPVYRTGIRKFVEKAKDAGADGMLIVDLPVT
HAGEFLDIAREEGIKTVFLAAPNTPDERLKEIDKATTGFVYLISLYGTTGARDRIPETAF
KLLRRAKKICKNKVAVGFGVSKREHVESLFEAGADGVVVGSALIEVINKLEPSHSKQTIF
TELQMKMRELSGI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaggatcattccataatcccgtatttaacggctggagaccctactgtagattca
actttagaattcctcctggcagtcgatgagtttgctggagcaatagagcttggcatacct
tttagcgacccgatggcagatggaaaaacaattcaggagtcacacttcagagccctcaaa
aacgggtttagactcgaagacgcattctatataataagagagttcagaaagcactcagaa
actcctcttgtgataatgacatactacaatccagtatatagaacgggtattaggaagttc
gttgagaaggctaaagatgccggggcagacgggatgctcatagttgacctcccagtcacc
cacgcgggagagtttttagacattgcgagagaagagggaattaaaaccgtctttcttgcc
gctccaaacacgccagacgaaaggctcaaagagatagataaagcaacaacaggattcgtt
tatctaatatccctctacggaaccactggggccagggatagaataccagaaactgctttt
aagctactaagaagggccaagaagatctgcaaaaataaggtggccgtaggcttcggagtt
tcgaagagagaacacgtagaaagcttgtttgaagcaggtgcagatggtgttgtcgtgggt
agtgcattgatagaagtgataaataaattggaaccatcccatagcaaacagacaatattc
acggaattacagatgaagatgagagagctctctggaatctaa

DBGET integrated database retrieval system