KEGG   Pyrococcus sp. ST04: Py04_1656Help
Entry
Py04_1656         CDS       T02124                                 

Definition
histidinol dehydrogenase HisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pys  Pyrococcus sp. ST04
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pys01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pys00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1627109..1628236)
Genome map
AA seq 375 aa AA seqDB search
MELEAYVREILEDIKRRGIEALKEYSRKFDNYEGPFRVSDEEFEEAESQISDRDKEIIKR
TIERIKKYHLTQLPRDKLLIRNGSLYGIIYRPIRRIGIYVPGGKPLPSTLMMVGVPARIA
GVKEIVVTTPPKEGKVNPYILYVAKLLGISEVYKLGGIQAIAAMAYGVGMRKVEKIFGPG
NKFVNEAKRQVFGIVGIDSLAGPSEIAVIADETANKEYVLADLLSQLEHGKDSKAWLLTT
SKELAEFCSRNGIEVILCKTLEECAERANEIAPEHLEIITKDPLLLLDLIENAGAVYLGP
YTPVPAADYFLGVNHVLPTGGAAKFMGVLTVLDFMKPISLAMVDREEFLRERYLGIRLAE
IEGMDMHKKSMEVRK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgaggcatatgttagggaaatactggaggatatcaagaggagagggattgaa
gcactcaaggagtactctcggaagtttgacaattatgagggccctttcagggttagtgat
gaggagtttgaagaagctgaatctcagatatcggatagggataaggaaataattaaaagg
acaattgagaggataaagaagtatcatttgactcagcttccccgagataagctgttaatc
aggaacggatctctttatggaataatttacaggccaataaggagaatcggaatttacgtt
cctggagggaagcccctgccttcgactctaatgatggtgggggttcccgcaaggattgct
ggggttaaggagatcgttgtgacaacgcccccgaaagagggtaaggttaacccctacatc
ctttatgtggcaaagctacttgggattagtgaggtgtataagctgggaggcattcaggct
atagcggctatggcctatggcgttggaatgagaaaagttgaaaaaatttttggaccaggg
aataaattcgtaaatgaggcaaagaggcaggtttttggaattgtgggtatagatagtctt
gcaggtccttccgagatagccgttatagctgatgaaactgccaataaggagtatgttttg
gcagatttactaagtcagcttgaacatgggaaggacagcaaggcatggcttctcacgact
tcaaaggagcttgcggagttttgctctcggaatgggattgaggttatactatgtaagacg
cttgaagaatgtgctgaaagggcgaatgaaatagccccagagcacctggaaataataact
aaggatccactacttcttttggatttaatagaaaatgctggtgcagtttatctgggcccc
tatactccagttcctgcagctgattactttcttggggttaatcatgttcttcctaccgga
ggtgctgcaaagttcatgggtgtcctaacggttctcgattttatgaagccgataagcctg
gccatggtggatagggaggaattcctgagggagagatatcttggaatcagactcgccgaa
atagaggggatggatatgcataagaaaagcatggaggttaggaaatga

DBGET integrated database retrieval system