KEGG   Pyrococcus sp. ST04: Py04_1761Help
Entry
Py04_1761         CDS       T02124                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00010  Glycolysis / Gluconeogenesis
pys01100  Metabolic pathways
pys01110  Biosynthesis of secondary metabolites
pys01120  Microbial metabolism in diverse environments
pys01130  Biosynthesis of antibiotics
pys01200  Carbon metabolism
pys01230  Biosynthesis of amino acids
Module
pys_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pys_M00002  Glycolysis, core module involving three-carbon compounds
pys_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Py04_1761
Enzymes [BR:pys01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Py04_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFK23329
UniProt: I3RGG9
Position
1712975..1713979
Genome map
AA seq 334 aa AA seqDB search
MKVKVGVNGYGTIGKRVAYAVMKQDDMELIGVTKTKPDFEAYRAKELGIPVYAASEEFLP
RFEKAGFEVEGTLNDLLEKVDVIVDATPGGMGAKNKPLYEKAGVKAVFQGGEKADVAEVS
FVAQANYEKALGKDYVRVVSCNTTGLVRTLSAIQEYIDYVYAVMIRRAADPNDIKRGPIN
AIKPSVTVPSHHGPDVQTVIPINIETSAFVVPTTIMHVHSIMVELKKPIEAKDVINIFES
TTRVLLFEKEKGFESTAQLIEFARDLHREWNNLYEIAVWKESVSVRNGRLFYIQAVHQES
DVIPENIDAIRAMFELADKWESIRKTNKSLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaggtgggggttaatggttacggaaccatagggaaaagggttgcctatgcc
gttatgaaacaggacgatatggagcttataggggtcacaaaaacaaagccagactttgaa
gcttatagagctaaagaactaggaattccagtctatgcagctagtgaggaattccttcca
cgcttcgagaaggctgggttcgaagtagaggggacactaaacgacctccttgaaaaagtt
gacgtcatagttgatgcaactccaggaggtatgggagcgaagaacaaaccactatacgaa
aaagccggtgttaaggctgtttttcaaggaggagagaaggctgatgtggcagaagtatcc
ttcgttgcccaagccaactatgaaaaggctttgggaaaggactacgttagggtagtttca
tgcaatactactggacttgtgagaactctgagtgcaatccaagaatacatagactacgta
tacgctgttatgatcaggagggctgcagatccaaacgatataaagagaggcccaataaat
gctataaagccctcggtaacagttccttcccaccacggaccagacgttcaaactgttatt
ccaataaacatagaaacatctgcattcgttgttccaacaactataatgcatgtgcactct
ataatggttgaactcaagaagccaatagaggctaaagacgttatcaacattttcgaaagc
acaactagagttctcctctttgaaaaggagaaaggcttcgagagcacggctcagcttata
gagtttgcaagggatctccacagggaatggaacaacctgtatgagatagccgtatggaaa
gaaagcgtaagcgttaggaatggaaggttattctacattcaggcagttcatcaggagagc
gatgttattcccgagaacatagatgctataagggcaatgttcgagctcgcggataagtgg
gaaagcatcagaaagaccaacaagagtcttggaattctcaagtga

DBGET integrated database retrieval system