KEGG   Pyrococcus sp. ST04: Py04_1773Help
Entry
Py04_1773         CDS       T02124                                 

Definition
(GenBank) Ribokinase RbsK
  KO
K21056  
alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pys  Pyrococcus sp. ST04
Brite
Enzymes [BR:pys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     Py04_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1723070..1723957
Genome map
AA seq 295 aa AA seqDB search
MAGRLDVICMGNLNYDITFLMEKFPEFHEKVNAKAVYTGLGGSAGNTATWLAHLGLKVGF
IGAVGNDDFGRLHLEFFRKIGVDTKGIKVVEEPTGVAVMMVKGEDKRIVKYSGANKFKEI
NFEYLKLARHLHLSSNPIDLIREAVKAAKSFGLTVSFDPGEMEVPKDIEEKLDILMMNED
EFKRKYGSLENIKEIKSRIAIATLNGGGALVRDEKGKVYEVRGLSAKAVDTTGGGDSFNA
GFLYGFLNGWDTISSAKLGMLLAYLTVQKIGARSAVVPLERVREIAKTLNLDIPL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggccggaagattagacgttatttgcatgggaaatttaaactatgacataacattcctt
atggaaaagttcccagaattccatgagaaagttaatgccaaagctgtttacactggcctc
ggaggttcagctggaaacacggcaacttggctagcccacctagggcttaaagtaggcttt
ataggtgctgttggaaacgatgacttcggcaggcttcacttagaattcttcagaaagata
ggggtagacacaaagggcataaaggtagttgaagaaccaactggagtcgccgtcatgatg
gttaagggagaggacaagagaatagtgaaatattcaggggcaaacaagttcaaggaaata
aactttgagtatctaaagctagctaggcaccttcacttatcctcgaatccaatagaccta
atcagagaagccgtgaaagctgccaaatcttttggattaacggtgtcgttcgatccagga
gagatggaggttcccaaagatattgaggaaaagcttgacatcctcatgatgaacgaggat
gagtttaaaagaaagtatggaagtctggagaacatcaaagagataaagtcgaggatagcc
atagcaaccctcaacggaggaggagcacttgttagggatgagaaaggtaaggtttacgag
gtgagggggctatctgcaaaagccgtcgacactactggtgggggagattcattcaatgca
ggcttcctctacggatttcttaacggctgggacactattagctcggcgaaacttggaatg
ctgctggcttacttaacggttcagaaaatcggggcgagaagtgcggttgtacctttagaa
agggtaagagagattgcaaaaactttaaatctggacatacctctttag

DBGET integrated database retrieval system