KEGG   Phenylobacterium zucineum: PHZ_c0146Help
Entry
PHZ_c0146         CDS       T00750                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pzu  Phenylobacterium zucineum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PHZ_c0146 (tesA)
Enzymes [BR:pzu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PHZ_c0146 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PHZ_c0146 (tesA)
Lipid biosynthesis proteins [BR:pzu01004]
 Fatty acid synthase
  Component type
   PHZ_c0146 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137173..137835
Genome map
AA seq 220 aa AA seqDB search
MPSRLTRRGLLALAAASAAAPGALAAPVRPAPIRRVSILGDSIAVGFGLPAGQALPARLQ
AELARLGVPARVTPAGRVGDTTAGGLRRLDRAAPAGTDLVVVALGGNDLLLGAEPREVRA
NLDAIVRRLKARGVRVVLAGVRAPPLLSGAWASAFDEAFASVARTHRVTFVPDMLAGVAL
NPRLNQRDGIHPNAAGVEVIARRLAPSVAKALMTGRTAAG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccgcctcacccgccgcggcctcctggcgctcgccgcggcctcggccgccgcc
cccggtgcattggcggcccccgtccgtcctgccccgatccgtcgcgtctcgatcctgggg
gactcgatcgccgtcggcttcggcctgccggcgggccaggccctgccggccaggctgcag
gccgagctcgcccgcctgggcgtgcccgcccgcgtcacgcccgcgggccgggtcggcgac
actacggccggcggcctgcgccgcctggaccgcgccgcgccggctgggaccgacctcgtc
gtcgtggccctcggcggcaacgacctgctgctcggcgccgagccgcgcgaggtgcgcgcc
aacctcgacgccatcgtgcggcggctgaaggcccgcggggtgcgcgtggtgctggccggg
gtccgcgcgccgccgctcctgagcggcgcctgggccagcgccttcgacgaggccttcgcc
agcgtcgcccgcacgcaccgcgtgaccttcgtgcccgacatgctggccggggtggcgctc
aacccgcgcctgaaccagcgcgacggcatccatccgaacgccgccggcgtcgaggtcatc
gcccggcggctcgccccgtccgtggcgaaagccctgatgaccggacgcacggccgcgggc
taa

DBGET integrated database retrieval system