KEGG   Phenylobacterium zucineum: PHZ_c0158Help
Entry
PHZ_c0158         CDS       T00750                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pzu  Phenylobacterium zucineum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c0158 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHZ_c0158 (sucC)
   00640 Propanoate metabolism
    PHZ_c0158 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PHZ_c0158 (sucC)
Enzymes [BR:pzu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PHZ_c0158 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146943..148142
Genome map
AA seq 399 aa AA seqDB search
MNIHEHQAKAVLAEFGVAVPRGYPAFSVDEAVQAAEKLGGPVFVVKSQIHAGGRGKGRFE
GLGPDAKGGVRVVKSVDEVKANAEEMLGRVLVTHQTGAAGKQVNRLYIEEGAQIAKEFYL
SLLVDRETSWVSVVASTEGGMDIEEVAHATPEKIVTFSIDPATGVFPHHGRHLAKALGLT
GGLAKEAATLLNQLYAAFLAKDMSMLEINPLIVTGDDHLRVLDAKVSFDSNALFRHADVV
ALRDESEEDPKEIEASKYDLSYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPNVKGILVNIFGGIMRCDIIAEGVVAAVKEVGLKVPLVVRLE
GTNVDLGKKIINESGLNVIAANDLSDGAEKIVKAVRGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaacatcaagccaaagccgtcctcgcagagttcggcgtggccgtcccg
cgcgggtatcccgcgttctccgtcgatgaagccgtccaggccgccgagaagctcggcggc
cctgtctttgtggtgaagtcccagatccacgccggcgggcgcggcaagggccggttcgag
ggcctgggccccgacgccaagggcggcgtgcgcgtcgtcaagtcggtggacgaggtgaag
gccaacgccgaggagatgctgggccgggtgctcgtgacccaccagaccggcgcggccggc
aagcaggtgaaccgcctctacatcgaggaaggcgcgcagatcgccaaggaattctacctg
tcgctgctggtggaccgcgagacgagctgggtctcggtcgtggcctccaccgagggcggc
atggacatcgaggaagtggcgcacgccacgcccgagaagatcgtcaccttctccatcgac
ccggccaccggcgtcttcccgcaccacggccgccacctggccaaggcgctgggcctgacc
ggcggcctcgccaaggaagcggccacgctgctgaaccagctctacgcggcgttcctggcc
aaggacatgtcgatgctggagatcaacccgctgatcgtcacgggcgatgatcacctgcgg
gtgctggacgccaaggtcagcttcgactccaacgccctgttccgccacgccgacgtcgtc
gcgctgcgcgacgagagcgaggaggacccgaaggagatcgaggcctccaagtacgacctc
agctacatcgccctggacggcgagatcggctgcatggtcaacggcgcgggcctggccatg
gccaccatggacatcatcaagctctacggcgccgagcccgccaacttcctcgacgtgggc
ggcggggccagcaaggagaaggtgacggccgccttcaagatcatcaccgcggacccgaac
gtgaagggcatcctggtgaacatctttggcggcatcatgcgctgcgacatcatcgccgag
ggcgtggtggccgcggtcaaggaagtgggcctgaaggtgccgctggtcgtccgcctcgag
ggcacgaacgtcgacctgggcaagaagatcatcaacgagagcggcctgaacgtgatcgcc
gcgaacgatctgtcggacggagccgagaagatcgtgaaggccgtccggggggctgcgtaa

DBGET integrated database retrieval system