KEGG   Phenylobacterium zucineum: PHZ_c0158Help
Entry
PHZ_c0158         CDS       T00750                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit sucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00020  Citrate cycle (TCA cycle)
pzu00640  Propanoate metabolism
pzu00660  C5-Branched dibasic acid metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
Module
pzu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pzu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHZ_c0158 (sucC)
   00640 Propanoate metabolism
    PHZ_c0158 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PHZ_c0158 (sucC)
Enzymes [BR:pzu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PHZ_c0158 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACG76572
UniProt: B4RCH3
Position
146943..148142
Genome map
AA seq 399 aa AA seqDB search
MNIHEHQAKAVLAEFGVAVPRGYPAFSVDEAVQAAEKLGGPVFVVKSQIHAGGRGKGRFE
GLGPDAKGGVRVVKSVDEVKANAEEMLGRVLVTHQTGAAGKQVNRLYIEEGAQIAKEFYL
SLLVDRETSWVSVVASTEGGMDIEEVAHATPEKIVTFSIDPATGVFPHHGRHLAKALGLT
GGLAKEAATLLNQLYAAFLAKDMSMLEINPLIVTGDDHLRVLDAKVSFDSNALFRHADVV
ALRDESEEDPKEIEASKYDLSYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPNVKGILVNIFGGIMRCDIIAEGVVAAVKEVGLKVPLVVRLE
GTNVDLGKKIINESGLNVIAANDLSDGAEKIVKAVRGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaacatcaagccaaagccgtcctcgcagagttcggcgtggccgtcccg
cgcgggtatcccgcgttctccgtcgatgaagccgtccaggccgccgagaagctcggcggc
cctgtctttgtggtgaagtcccagatccacgccggcgggcgcggcaagggccggttcgag
ggcctgggccccgacgccaagggcggcgtgcgcgtcgtcaagtcggtggacgaggtgaag
gccaacgccgaggagatgctgggccgggtgctcgtgacccaccagaccggcgcggccggc
aagcaggtgaaccgcctctacatcgaggaaggcgcgcagatcgccaaggaattctacctg
tcgctgctggtggaccgcgagacgagctgggtctcggtcgtggcctccaccgagggcggc
atggacatcgaggaagtggcgcacgccacgcccgagaagatcgtcaccttctccatcgac
ccggccaccggcgtcttcccgcaccacggccgccacctggccaaggcgctgggcctgacc
ggcggcctcgccaaggaagcggccacgctgctgaaccagctctacgcggcgttcctggcc
aaggacatgtcgatgctggagatcaacccgctgatcgtcacgggcgatgatcacctgcgg
gtgctggacgccaaggtcagcttcgactccaacgccctgttccgccacgccgacgtcgtc
gcgctgcgcgacgagagcgaggaggacccgaaggagatcgaggcctccaagtacgacctc
agctacatcgccctggacggcgagatcggctgcatggtcaacggcgcgggcctggccatg
gccaccatggacatcatcaagctctacggcgccgagcccgccaacttcctcgacgtgggc
ggcggggccagcaaggagaaggtgacggccgccttcaagatcatcaccgcggacccgaac
gtgaagggcatcctggtgaacatctttggcggcatcatgcgctgcgacatcatcgccgag
ggcgtggtggccgcggtcaaggaagtgggcctgaaggtgccgctggtcgtccgcctcgag
ggcacgaacgtcgacctgggcaagaagatcatcaacgagagcggcctgaacgtgatcgcc
gcgaacgatctgtcggacggagccgagaagatcgtgaaggccgtccggggggctgcgtaa

DBGET integrated database retrieval system