KEGG   Phenylobacterium zucineum: PHZ_c0161Help
Entry
PHZ_c0161         CDS       T00750                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pzu  Phenylobacterium zucineum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c0161 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHZ_c0161 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PHZ_c0161 (sucB)
Enzymes [BR:pzu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PHZ_c0161 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152118..153398
Genome map
AA seq 426 aa AA seqDB search
MADIMTPALGESVTEATVARWTKKAGDAVRKDEILVELETDKVSLEVAAPADGVLAEIAA
DEGATVEPGAVLGRITEGAGAPAPKAEAPKAAAPSSTPTPVPAGELQPEPTPGKAVPTSA
PVPDTSAPQGGAKAEKVLAPSAQRIVGENKLDAGAIQGTGKDGRVTKADALAALESRAKA
PAAPQAPSAPRELHEREERVRMTRLRQTIARRLKEAQNAAAMLTTFNEVDMTNVMALRNQ
YKDQFEKKHGVKLGFMSFFVRAVIHGLKQVPEVNAEIDGTDIIYKNHYDISVAVGTDKGL
VTPVVRDADMMSLAEIEKEIGALGKKARDGQLALEDLQGGTFTISNGGVYGSLMSTPILN
APQSGILGMHKIQERPMVVGGQIVARPMMYLALSYDHRIVDGKGAVTFLVHVKEAIEDPQ
RLLLDV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcatgacgccagcgctgggcgaatccgtcaccgaagcgacggtggcgcgc
tggacgaagaaggccggtgacgccgtccgcaaggacgagatcctcgtcgagctcgagacg
gacaaggtgagcctggaagtggccgcccccgccgacggcgtgctggccgagatcgccgcc
gacgaaggcgcgacggtcgagcccggcgccgtgctgggccgcatcaccgaaggcgccggc
gccccggcgccgaaggccgaggcgcccaaggcggccgccccgtcgtccacgccgacgccg
gtcccggccggcgagctgcagcccgagccgacccccggcaaggccgtcccgacctcggcc
ccggtgccggatacgtcggctccccagggaggggccaaggccgagaaggtgctggcgccg
tcggcccagcggatcgtcggcgagaacaagctggacgccggcgccattcagggcaccggc
aaggacggccgggtgaccaaggccgacgccctcgccgcgctggagtcccgcgccaaggcg
ccggccgccccgcaggcaccgtccgcgccgcgcgagctgcacgagcgcgaggagcgggtc
cgcatgacccgcctgcgccagaccatcgcgcgccggctgaaggaggcgcagaacgccgcg
gccatgctgaccaccttcaacgaggtggacatgacgaacgtcatggccctgcggaaccag
tacaaggaccagttcgagaagaagcacggcgtgaagctgggcttcatgagcttcttcgtc
cgcgcggtgatccacggcctgaagcaggtgcccgaggtcaacgccgagatcgacggcacg
gacatcatctacaagaaccactacgacatctcggtcgcggtgggcaccgacaagggcctc
gtgacgcccgtcgtccgcgacgccgacatgatgagcctggccgagatcgagaaggagatc
ggcgcgctcggcaagaaggcccgcgacggccagctggcgctggaggacctgcagggcggc
acgttcaccatctcgaacggcggcgtgtacggctcgctgatgtcgacgccgatcctgaac
gccccgcagtcgggcatcctcggcatgcacaagatccaggagcggccgatggtggtcggc
ggccagatcgtcgcccggccgatgatgtaccttgcgctcagctacgatcaccgcatcgtc
gacggcaagggcgcggtgaccttcctggtccacgtcaaggaagccatcgaggacccgcag
cgcctgctgctggacgtctga

DBGET integrated database retrieval system