KEGG   Phenylobacterium zucineum: PHZ_c0195Help
Entry
PHZ_c0195         CDS       T00750                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHZ_c0195 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHZ_c0195 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHZ_c0195 (trpB)
Enzymes [BR:pzu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHZ_c0195 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
187922..189142
Genome map
AA seq 406 aa AA seqDB search
MNAPSRPNDYAAYPDLKGRFGDYGGQYVPETLMPLVHELTAAYEAAKADPAFQAELAGYL
THYVGRPSPLYFAERLTRHYGGAKIYLKREELNHTGSHKINNCMGQILLAQRMGKTRIIA
ETGAGQHGVATATVCARFGLPCVVYMGAVDVERQKPNVFRMNLLGAEVRPVTSGSATLKD
AMNEALRDWVTNVHDTYYLIGSAAGMHPYPMMVRDFQAVIGRETREQILELEGRLPDALV
ACVGGGSNAIGLFHPFLNDSSVKIFGVEAAGEGVETGRHAAAINGGRPGVLHGNMTYLLQ
DRVGQIEEAHSISAGLDYPGIGPEHAWLHDVGRATYLTATDTEALEAFRLLSELEGILPA
IESSHALARLPEITREVGKDGIVVLNLSGRGDKDVNTVASYLGRQI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcgccttcccgtccgaacgactacgcggcctatcccgacctcaaggggcggttc
ggcgactacggcggccagtacgtgccggaaaccctgatgccgctggtgcacgagctgacc
gccgcctacgaggcggccaaggccgaccccgccttccaggccgagctggccggctacctg
acccactacgtgggccggccctcgccgctctatttcgccgagcgcctgacgaggcactac
ggcggggcgaagatctatctcaagcgggaggagctgaaccacaccggctcgcacaagatc
aacaactgcatgggccagatcctgctggcccagcggatgggcaagacgcggatcatcgcc
gagaccggcgccggccagcacggcgtcgccacggccaccgtctgcgcccgcttcggcctg
ccgtgcgtggtctacatgggcgcggtggacgtcgagcggcagaagccgaacgtgttccgc
atgaacctgctgggcgccgaggtgcggccggtgaccagcggatcggccaccctgaaggac
gccatgaacgaggcgctccgcgactgggtcaccaacgtccacgacacctattacctgatc
ggctcggcggcggggatgcacccctatccgatgatggtccgcgacttccaggcggtgatc
ggccgcgagacgcgcgagcagatcctggagctggagggccgcctgcccgacgcgctggtc
gcctgcgtcggcggcggctcgaacgccatcggcctgttccacccgttcctgaacgactcc
tcggtgaagatcttcggcgtcgaggcggcgggcgagggggtcgagaccggccgccacgcc
gcagcgatcaacggcggccgccccggcgtgctgcacgggaacatgacctacctgctgcag
gaccgggtggggcagatcgaggaggcgcactccatctcggccggcctcgactatccgggc
atcggccccgagcacgcctggctgcacgacgtgggccgcgccacctacctgaccgccacc
gacacggaggcgctggaggcgttccgcctgctgtccgagctggagggcatcctgccggcg
atcgagagctcgcacgccctggcccgcctgcccgagatcacccgcgaggtgggcaaggac
gggatcgtcgtgctgaacctgtcgggccgcggcgacaaggacgtgaacaccgtcgcgagc
tacctggggcggcagatttga

DBGET integrated database retrieval system