KEGG   Phenylobacterium zucineum: PHZ_c0196Help
Entry
PHZ_c0196         CDS       T00750                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00260  Glycine, serine and threonine metabolism
pzu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01130  Biosynthesis of antibiotics
pzu01230  Biosynthesis of amino acids
Module
pzu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHZ_c0196 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHZ_c0196 (trpA)
Enzymes [BR:pzu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHZ_c0196 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACG76610
UniProt: B4RCL1
Position
189139..189972
Genome map
AA seq 277 aa AA seqDB search
MTKARIDARFAELAREGRAAFVPYVMAGDPDRETALAILKGLPAAGADIIELGFPFSDPM
AEGPPIQRAAGRALAKGMTLQGVLDLVRAFRAGDATTPLILMGYMNPLVTWGLEAFARDA
SDAGVDGLIIVDCPPEEADPLADALDAAGVSLIRLATPTTGDARLKVVVRRTSGFVYYVS
VAGVTGVKEADAAAVAPNVERVRKASGLPVAVGFGIKTPERAAQVAQVADAVVVGSALVD
EVAEAVDMNEDVTARVLSKVESLAKAVRLARRSHEAV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaaggcccgcatcgacgcccgcttcgccgaactcgcgcgcgagggccgcgcggcc
ttcgtgccctatgtgatggccggcgatcccgaccgggagacggcgctcgccatcctgaag
ggcctgcccgcggcgggggcggacatcatcgagctgggcttcccgttctcggacccgatg
gccgaggggccgccgatccagcgcgccgcgggccgggcgctcgccaagggcatgacgctg
cagggcgtgctggacttggtccgcgccttccgcgcgggggacgcgacgacgccgctgatc
ctgatgggctacatgaaccccctcgtcacctgggggctggaggccttcgcccgcgacgcc
tcggacgccggggtggacgggctgatcatcgtggactgcccgcccgaggaggccgatccg
ctggccgacgccctggacgcggcgggcgtctcgctgatccggctggcgacgccgacgacc
ggcgatgcgcggctgaaggtggtggtccggcggacctcgggcttcgtctactacgtctcg
gtggccggggtgacgggagtgaaggaggccgacgcggccgccgtcgcgcccaacgtggag
cgggtccgcaaggcctcgggcctgcccgtcgcggtcggcttcggcatcaagactccggaa
agggccgcgcaggtagcccaggtcgccgacgcggtcgtggtgggttccgcgcttgtggac
gaagtcgccgaagcagtggacatgaacgaagacgtgaccgcgcgagttctttccaaagtc
gaatccttggctaaggctgtgcgccttgcgcgtcgtagccacgaggcggtctga

DBGET integrated database retrieval system