KEGG   Phenylobacterium zucineum: PHZ_c0211Help
Entry
PHZ_c0211         CDS       T00750                                 

Definition
succinate dehydrogenase,hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pzu  Phenylobacterium zucineum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c0211
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHZ_c0211
   00650 Butanoate metabolism
    PHZ_c0211
  Energy metabolism
   00190 Oxidative phosphorylation
    PHZ_c0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208652..209071
Genome map
AA seq 139 aa AA seqDB search
MGDRRHDGSPLMSSFRTPLSRAKGLGSAKHGVGHWIGERVSAAALIPLTLWAVYAVIRLA
ALDYYGAVAWISTPLNMTLMVLTLAFSFWHMHAGLRVVVEDYIHKTLSKAALLLLNFFVC
GLAGALAVFSVLKVALGGA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgatcgccggcatgacgggagccctctgatgtccagcttccgcacccctctttcg
cgggccaagggcctgggctcggccaagcacggcgtcggccactggatcggcgagcgcgtc
agcgccgcggccctgatcccgctgaccctgtgggccgtctacgccgtcatccgcctggcg
gcgctggactactacggcgcggtcgcctggatctcgacgccgctgaacatgacgctgatg
gtcctgacgctggcgttcagcttctggcacatgcacgccggcctgcgggtggtcgtcgag
gactacatccacaagaccctgagcaaggccgcgctcctgctcctcaacttcttcgtctgc
ggactggccggcgcgctcgccgtcttctccgtgctgaaggtcgcgctgggaggcgcgtga

DBGET integrated database retrieval system