KEGG   Phenylobacterium zucineum: PHZ_c0371Help
Entry
PHZ_c0371         CDS       T00750                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pzu  Phenylobacterium zucineum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pzu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375463..376065
Genome map
AA seq 200 aa AA seqDB search
MAASAGPEIERLIGLLAKLPGLGPRSARRAALALLKRRDQLLAPLSDALAEAAARVKTCS
TCGSLDTQDPCAICSDGTRDASLICVVEEVGALWAMERAGAFRGRYHVLGGLLSALDGVG
PDALRVGPLVARASEPGVREVILALPATVDGQTTAHYLAERLAGAEVTVSMLARGVPVGG
ELDWLDDGTIAQAMRARRPA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctccgccggacccgagatcgagcggctgatcgggctgctcgccaagctgccg
gggctgggaccgcggtcggcgcggcgcgcggcgctggccctgctgaagcggcgcgaccag
ctcctggcgccgctgtccgacgccctggccgaggcggcggcgcgggtgaagacctgttcg
acgtgcggcagcctcgacacccaggacccctgcgcgatctgttccgacgggacgcgggac
gccagcctgatctgcgtggtcgaggaggtcggcgcgctgtgggccatggagcgggcgggc
gcgttccgcggccgctaccacgtgctgggcgggctgctgtcggcgctggacggcgtgggg
ccggacgccctgcgggtcgggcccctggtggcgcgggccagcgagcccggcgtgcgcgag
gtgatcctggccctgccggcgaccgtcgatggccagacgacggcgcactacctggccgag
cggctggccggcgcggaggtgacggtcagcatgctggcccgcggcgtgccggtgggcggc
gagctggactggctggacgacggcaccatcgcccaggccatgcgggcgcgccggccggca
tag

DBGET integrated database retrieval system