KEGG   Phenylobacterium zucineum: PHZ_c0451Help
Entry
PHZ_c0451         CDS       T00750                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c0451
   01230 Biosynthesis of amino acids
    PHZ_c0451
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c0451
   00030 Pentose phosphate pathway
    PHZ_c0451
   00051 Fructose and mannose metabolism
    PHZ_c0451
   00052 Galactose metabolism
    PHZ_c0451
  Energy metabolism
   00680 Methane metabolism
    PHZ_c0451
Enzymes [BR:pzu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PHZ_c0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(459309..460271)
Genome map
AA seq 320 aa AA seqDB search
MPVVVTLTLNPALDVSTSTPRVEPDRKLRCGAGRRDPGGGGINVARVAHRLGARTLAIFP
SGGLTGQMLERLVEAEGVGSLPVPVSGETREDVTVLDESSGAQYRFIMPGPHLHGVEWMA
CLKALAGLEAKPDFVCASGSLPPGAPDDLYARVAEIVESWGVRFALDTSGPPLQAALSER
VFLIKPNLRELRELTGAPLEDEASRIAACRSLIARGRTAAVALTLGHEGALLVTAQDAWR
APALPVRPVSSVGAGDSFLGAMVWGLASKLTLREAFAFAMAGGSAALLAQGTQLAGARDV
RRLLPQVTVERVDDRAALRA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgtcgtcaccctgacgctcaaccccgccctggatgtctcgacctcgacgccg
cgggtcgagcccgaccgcaagctccgctgcggcgccggccggcgcgatcccggcggcggg
gggatcaacgtcgcccgcgtcgcccaccgcctgggcgcgcgcacgctggcgatcttcccc
tcgggcggcctcaccggccagatgctggagcgcctcgtcgaggccgaaggggtgggaagc
ctgcccgtgccggtctcgggcgagacccgcgaggacgtcaccgtgctcgacgagtcctcg
ggcgcccagtaccgcttcatcatgccggggccccatctgcacggggtcgaatggatggcc
tgcctgaaggcgctggcggggctcgaggccaagcccgacttcgtctgcgccagcggcagc
ctgccgcccggcgcccccgacgacctctacgcgcgggtggccgagatcgtggagagctgg
ggcgtccgcttcgccctggacacctcgggcccgccgctgcaggcggcgctttccgaacgc
gtcttccttatcaagcccaacctgcgcgagctgcgcgaactcaccggcgcgccgctggag
gacgaggcgagccgcatcgccgcctgtcggtccctgatcgcgcggggccgcacggccgcc
gtggccctcaccctcggccacgagggcgcgctgctcgtcaccgcccaggacgcctggcgc
gcccccgccctgccggtgaggccggtcagcagcgtcggcgccggcgacagcttcctgggc
gccatggtctggggcctcgcctccaagctgaccctgcgcgaggcattcgccttcgccatg
gcgggcgggtcggccgccctgctggcccagggcacccagctcgccggcgcccgcgacgtg
cgccgcctgctcccgcaagtgaccgtcgagcgcgtcgacgaccgggccgcgctgcgggcc
tag

DBGET integrated database retrieval system