KEGG   Phenylobacterium zucineum: PHZ_c0461Help
Entry
PHZ_c0461         CDS       T00750                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pzu  Phenylobacterium zucineum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PHZ_c0461
Enzymes [BR:pzu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PHZ_c0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476349..477785
Genome map
AA seq 478 aa AA seqDB search
MILPRSSPAVRPERLAGVRKVEVRAGEVTILATPMISEDGLLQPGELGLPQPAFRRLGVR
PGDPVHVAPARSPRTLEAVRAKIAGASLTPDDYEAITGDLAAHRWSDMEIAAFLVACAAF
MTPEEVLSLTKAMVTAGRRLSWNRDLVVDKHCIGGIPGNRTTLIVTPIVAAHGLTMPKTS
SRAITSPAGTADTMEVFARVDLSEAEMRQVVETCGACVSWGGRVNLSPADDVLISVERPL
SIDTPEQMVASIVSKKLAAGSTHLVLDVPVGPTAKVRDRRQALRLKKLFEYVADGTGLSI
EVLLTDAIEPIGRGVGPVLEARDVTAVLENRADAPEDLREKSIRLAGRVLEVDPALRGGA
GERRARELLESGAAAEKMAQICEAQGASPLKNATGDLIHEVRAAGSGRVAAIDCLRIATI
ARLAGAPTDPGAGLELLRKTGETVRTGEPLYRIYGSEISDFGFACEATGEDPGVRIES
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctgccgcggtcgagcccggccgtgcggccggagcggctggcgggcgtgcgcaag
gtcgaggtgcgggccggcgaggtgaccatcctcgccacgccgatgatctcggaggacggc
ctgctgcagcctggcgagctgggcctgccgcaaccggcgttccggcgcctgggcgtgcgg
cccggcgatccggtgcacgtcgcgcccgcccgctcgccgcgcaccctcgaggcggtccgg
gcgaagatcgccggcgccagcctgacgccggacgactacgaggccatcaccggggacctg
gcggcgcaccgctggtccgacatggagatcgccgccttcctcgtggcctgcgccgcgttc
atgacgccggaggaggtgctgtcgctgaccaaagcgatggtgacagccggccggcggctg
agctggaaccgcgacctggtggtggacaagcactgcatcggcggcatccccggcaaccgc
acgacgctgatcgtcacgcccatcgtggcggcgcacggcctgaccatgcccaagacctcg
tcgcgggccatcacctcgcccgcggggaccgccgacaccatggaggtcttcgcccgggtc
gacctcagcgaggccgagatgcggcaggtggtggagacctgcggggcctgcgtctcgtgg
ggcgggcgggtgaacctgtcccccgccgacgacgtgctgatctcggtggagcgcccgctg
tccatcgacacgcccgagcagatggtcgcctcgatcgtctcgaagaagctggcggcgggc
tcgacccacctcgtgctcgacgtgccggtcggtcccacggccaaggtccgcgacaggcgc
caggcgctgcggctgaagaagctgttcgaatacgtcgccgacgggaccgggctgtccatc
gaggtgctgctgaccgacgctatcgagccgatcggccgcggcgtcggcccggtgctggag
gcgcgcgacgtcaccgccgtgctggagaaccgcgccgacgcgcccgaggacctgagggag
aagtcgatccggctggccggccgggtgctggaggtggatcccgccctgcgcggcggggcc
ggcgagcgccgggcgcgcgagctgctggagagcggggcggcggccgagaagatggcccag
atctgcgaagcccagggcgcctcgccgctgaagaacgccaccggcgacctgatccacgag
gtgcgggcggccggctcgggccgggtggccgccatcgactgcctgcggatcgccaccatc
gcccggctggcgggcgccccgacggatcccggcgcggggctggagctgctgcgcaagacc
ggcgagacggtgcgcacgggcgagccgctctaccggatctacggctcggagatctcggac
ttcggcttcgcctgcgaggccacgggcgaggaccccggcgtgcggatcgaatcatga

DBGET integrated database retrieval system