KEGG   Phenylobacterium zucineum: PHZ_c0549Help
Entry
PHZ_c0549         CDS       T00750                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHZ_c0549 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHZ_c0549 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PHZ_c0549 (thrC)
Enzymes [BR:pzu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PHZ_c0549 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580431..581819
Genome map
AA seq 462 aa AA seqDB search
MRYVSTRGQCPAVGFTDAVLSGLAPDGGLYVPEAWPTFSRARIEGFAGKPYAEVAAAVIG
AFAGDEIPAADLREMCEEAYATFNHKAVVPLVQIGPDAFLAELFHGPSLAFKDVAMQILA
RLYDHLLGAQGRTQTILCATSGDTGGAAVEAFRGRKNVKIVALFPEGRISEVQRRFMTTA
EEDNVACVAVTGTFDDCQAIVKQAFQDQSLRQAVDLTGVNSINFARIAAQAVYYFTTAVA
LGAPHRKVSFCVPSGNFGDAFAGYVAMRMGLPVARIATATNANDILARAFETGRYVRGAV
QPTISPAMDIQSASNFERLYFETVKREPVETARAFQAFAEAGAIDIPPSAYAAMREVFRG
VSIGEDETARTIVSTLNETGELIDPHTAVGVAALRHVDLPGPVVVLSTAHAAKFPDDVAK
ACGAMPALPRGVANLADRRERFDRLPAEAETIKAYVRAFAER
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtctcgacccgcgggcagtgccccgcggtcggcttcaccgatgcggtcctc
tcgggcctggcccccgacggcgggctctatgtgcccgaggcctggccgacgttcagccgc
gcccggatcgagggcttcgccggcaagccgtatgccgaggtcgccgccgcggtgatcggc
gccttcgcgggcgacgagatccccgccgccgacctgcgcgagatgtgcgaggaggcctac
gccaccttcaaccacaaggccgtcgtgccgctggtccagatcgggcccgacgcgttcctg
gccgagctgttccatgggccctcgctcgcgttcaaggacgtggcgatgcagatcctggcg
cggctgtacgaccacctgctgggcgcgcaggggcggacgcagacgatcctctgcgccacc
tcgggcgacacgggcggggcggcggtggaggccttccgcggccggaagaacgtgaagatc
gtggcgctcttccccgagggccggatctcggaggtccagcgccggttcatgaccacggcc
gaggaggacaacgtcgcctgcgtggcggtgacgggcaccttcgacgactgccaggccatc
gtgaagcaggccttccaggaccagtccctgcgccaggccgtggacctgacgggcgtcaat
tcgatcaacttcgcccgcatcgccgcccaggcggtctactacttcaccaccgccgtcgcg
ctcggggccccgcaccggaaggtcagcttctgcgtcccgtcgggcaatttcggcgacgcc
ttcgccggctacgtggccatgcgcatggggctgccggtggcgcgcatcgccacggcgacc
aatgcgaacgacatcctggcccgcgcgttcgagaccggccgctacgtgcgcggcgcggtc
caacccaccatctctccggccatggacatccagtcggcgtcgaacttcgagcggctctac
ttcgagaccgtcaagcgcgagccggtcgagacggcccgcgccttccaggcgttcgccgag
gccggcgccatcgacatcccgcccagcgcctacgccgccatgcgcgaggtcttccggggc
gtgagcatcggcgaggacgagacggcccgcacgatcgtctcgacgctgaacgagacgggc
gagctgatcgacccgcacaccgccgtgggcgtcgccgccctgcgccacgtggacctgccc
gggcccgtggtcgtgctttccaccgcccacgccgccaagttcccggacgacgtggccaag
gcctgcggcgccatgccggccctgccgcggggcgtcgccaacctcgccgaccgacgcgag
cgcttcgaccggctgccggccgaggccgagaccatcaaggcctatgtccgcgcgttcgcc
gagcgctga

DBGET integrated database retrieval system