KEGG   Phenylobacterium zucineum: PHZ_c0549Help
Entry
PHZ_c0549         CDS       T00750                                 

Gene name
thrC
Definition
(GenBank) threonine synthetase protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00260  Glycine, serine and threonine metabolism
pzu00750  Vitamin B6 metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01230  Biosynthesis of amino acids
Module
pzu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHZ_c0549 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PHZ_c0549 (thrC)
Enzymes [BR:pzu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PHZ_c0549 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACG76963
UniProt: B4REX5
Position
580431..581819
Genome map
AA seq 462 aa AA seqDB search
MRYVSTRGQCPAVGFTDAVLSGLAPDGGLYVPEAWPTFSRARIEGFAGKPYAEVAAAVIG
AFAGDEIPAADLREMCEEAYATFNHKAVVPLVQIGPDAFLAELFHGPSLAFKDVAMQILA
RLYDHLLGAQGRTQTILCATSGDTGGAAVEAFRGRKNVKIVALFPEGRISEVQRRFMTTA
EEDNVACVAVTGTFDDCQAIVKQAFQDQSLRQAVDLTGVNSINFARIAAQAVYYFTTAVA
LGAPHRKVSFCVPSGNFGDAFAGYVAMRMGLPVARIATATNANDILARAFETGRYVRGAV
QPTISPAMDIQSASNFERLYFETVKREPVETARAFQAFAEAGAIDIPPSAYAAMREVFRG
VSIGEDETARTIVSTLNETGELIDPHTAVGVAALRHVDLPGPVVVLSTAHAAKFPDDVAK
ACGAMPALPRGVANLADRRERFDRLPAEAETIKAYVRAFAER
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtctcgacccgcgggcagtgccccgcggtcggcttcaccgatgcggtcctc
tcgggcctggcccccgacggcgggctctatgtgcccgaggcctggccgacgttcagccgc
gcccggatcgagggcttcgccggcaagccgtatgccgaggtcgccgccgcggtgatcggc
gccttcgcgggcgacgagatccccgccgccgacctgcgcgagatgtgcgaggaggcctac
gccaccttcaaccacaaggccgtcgtgccgctggtccagatcgggcccgacgcgttcctg
gccgagctgttccatgggccctcgctcgcgttcaaggacgtggcgatgcagatcctggcg
cggctgtacgaccacctgctgggcgcgcaggggcggacgcagacgatcctctgcgccacc
tcgggcgacacgggcggggcggcggtggaggccttccgcggccggaagaacgtgaagatc
gtggcgctcttccccgagggccggatctcggaggtccagcgccggttcatgaccacggcc
gaggaggacaacgtcgcctgcgtggcggtgacgggcaccttcgacgactgccaggccatc
gtgaagcaggccttccaggaccagtccctgcgccaggccgtggacctgacgggcgtcaat
tcgatcaacttcgcccgcatcgccgcccaggcggtctactacttcaccaccgccgtcgcg
ctcggggccccgcaccggaaggtcagcttctgcgtcccgtcgggcaatttcggcgacgcc
ttcgccggctacgtggccatgcgcatggggctgccggtggcgcgcatcgccacggcgacc
aatgcgaacgacatcctggcccgcgcgttcgagaccggccgctacgtgcgcggcgcggtc
caacccaccatctctccggccatggacatccagtcggcgtcgaacttcgagcggctctac
ttcgagaccgtcaagcgcgagccggtcgagacggcccgcgccttccaggcgttcgccgag
gccggcgccatcgacatcccgcccagcgcctacgccgccatgcgcgaggtcttccggggc
gtgagcatcggcgaggacgagacggcccgcacgatcgtctcgacgctgaacgagacgggc
gagctgatcgacccgcacaccgccgtgggcgtcgccgccctgcgccacgtggacctgccc
gggcccgtggtcgtgctttccaccgcccacgccgccaagttcccggacgacgtggccaag
gcctgcggcgccatgccggccctgccgcggggcgtcgccaacctcgccgaccgacgcgag
cgcttcgaccggctgccggccgaggccgagaccatcaaggcctatgtccgcgcgttcgcc
gagcgctga

DBGET integrated database retrieval system