KEGG   Phenylobacterium zucineum: PHZ_c0695Help
Entry
PHZ_c0695         CDS       T00750                                 

Definition
chemotaxis response regulator (protein-glutamate methylesterase)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pzu  Phenylobacterium zucineum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PHZ_c0695
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PHZ_c0695
Enzymes [BR:pzu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PHZ_c0695
Two-component system [BR:pzu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PHZ_c0695
Bacterial motility proteins [BR:pzu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PHZ_c0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759642..760712
Genome map
AA seq 356 aa AA seqDB search
MKSPERPVRVMIVEDSLVVRQLLAHLIGRDPRFVVAAAVASAEEALAEIGRVKPDVISMD
IRLPGIDGLEATRRIMSEHPTPIVVIADSVEDRSLSISMNALRAGALSVVEKPVGVASAA
YERIAETITTQLFIMSSVPVIRRRSFAAGPAAAEPPPPPRGDAAFRRPAFVALAASTGGP
PALAKVLEGLPKTLEASVFVVQHMGEAFMEGFATWLAGLSPLPVALAEDGATAQPGRVYV
APGGRHLSVEGGGRMRLVASEPVSSQRPSANVLFSSLARSAAPQTVGVLLTGMGEDGAQG
LLELRRAGGYTIAEHQSSAVVYGMPAAAVRLKAAKEILPLDMIGPRLVHLAQRARP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcgcccgagcgccctgtccgcgtcatgatcgtcgaggactctctggtcgtgcgc
cagctcctcgcccacctgatcggccgcgatccccggttcgtggtcgccgccgccgtggcc
tcggccgaggaggcgctggccgagatcggccgggtgaagcccgacgtcatctcgatggac
atccggctgcccggcatcgacggcctcgaggccacccgccggatcatgagcgagcacccg
accccgatcgtggtgatcgccgactccgtcgaggaccgctcgctcagcatctcgatgaac
gcgcttcgggccggcgccctgagcgtggtggagaagcccgtgggcgtcgcctcggccgcc
tacgagcgcatcgccgagaccatcaccacccagctcttcatcatgagcagcgtgccggtg
atccgccggcgcagcttcgccgccggacctgcggcggccgagccgccgcccccgccgcga
ggcgatgcggccttccggcggccggccttcgtggccctggccgcctcgacgggcggaccg
cccgccctggccaaggtgctggagggcctgccgaagacgctggaggcttcggtcttcgtc
gtccagcacatgggcgaggcgttcatggagggcttcgcgacctggctggccgggctctcg
ccgcttccggtggcgctggccgaggatggggcgacggcccagccggggcgggtctatgtg
gcgccgggcggacggcacctgtcggtcgagggcggcgggcggatgcggctcgtcgccagc
gagcccgtgtccagccagcggccgtcggccaacgtgctcttctcatccctggcgcgcagc
gccgcgccgcagacggtgggcgtgctgctgaccggcatgggggaagacggcgcccagggg
ctgctcgaacttcgccgcgccgggggctacaccatcgccgagcaccagagcagcgcggtc
gtctacggcatgcccgccgcggcggtgcggctgaaggcggccaaggagatcctgccgctc
gacatgatcggaccgcggctcgtccatctggcgcagagggcccgcccgtga

DBGET integrated database retrieval system