KEGG   Phenylobacterium zucineum: PHZ_c0817Help
Entry
PHZ_c0817         CDS       T00750                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pzu  Phenylobacterium zucineum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pzu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pzu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(902351..902869)
Genome map
AA seq 172 aa AA seqDB search
MSHVILSAGPIARARNGVIGKDGALPWRLKSDLALFKRTTLGKPVIMGRKTWESLPKRPL
PGRTNIVLTRDQSYEAPGALVVEDFSEAVQIAREQAAEDGADEVCVIGGASLFELALKKA
QRLYLTEVHADVEGDVTLSPIDESRWREVSRENHPASDADDFPFTWRVLERL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgtgatcctttccgccgggcccatcgcgcgggcccgcaacggcgtcatcggc
aaggacggcgccctgccctggcggctgaagtccgacctggcgctgttcaagcgcaccacc
ctgggcaagccggtgatcatgggccgcaagacctgggagagcctccccaagcgccccctg
cccggccgcaccaacatcgtgctgacccgcgaccagagctacgaggcgccgggggcgctg
gtggtcgaggacttctcggaggccgtgcagatcgcccgcgagcaggcggccgaggacggc
gcggacgaggtgtgcgtgatcggcggcgcctcgctgttcgagctggcgctgaagaaggcc
cagcggctctacctcaccgaggtgcatgccgacgtcgagggagacgtgacgctctcgccc
atcgacgagagccgctggcgcgaagtctcccgcgagaaccaccccgcgtccgacgccgac
gacttccccttcacctggcgggtgctggagcgcctctga

DBGET integrated database retrieval system