KEGG   Phenylobacterium zucineum: PHZ_c1122Help
Entry
PHZ_c1122         CDS       T00750                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
pzu  Phenylobacterium zucineum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PHZ_c1122
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PHZ_c1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1285331..1285696
Genome map
AA seq 121 aa AA seqDB search
MLAASLALMLAASAPSAAEGARVFQRCFSCHSVDPAEGHVQGPNLAGIVGRRAGTRPGYS
YSPALRRARAGGLVWTEQALDHFLADPEAMIPGTEMSMPPLRKPRDRQAVIRFLQTTASP
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcggcaagcctcgctctgatgctggccgcctcggcgccctcggccgccgagggc
gcgcgggtgttccagcgctgcttctcctgccattcggtggaccccgccgagggccatgtg
caggggccgaacctggccgggatcgtggggcgccgagcgggcacgcggcccggctattcc
tattcgccggccttgcggcgggcgcgggcgggcgggctcgtctggaccgagcaggcgctg
gaccacttcctggccgaccccgaggcgatgatcccgggcaccgagatgagcatgccgccc
cttcgcaaaccgcgtgaccgccaggcggtgatccgcttcctccagaccacggcgagcccc
cgatga

DBGET integrated database retrieval system