KEGG   Phenylobacterium zucineum: PHZ_c1188Help
Entry
PHZ_c1188         CDS       T00750                                 

Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PHZ_c1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACG77602
UniProt: B4R8H5
Position
complement(1365412..1365918)
Genome map
AA seq 168 aa AA seqDB search
MRRLGPILATAVVAAALASCGKSSTEQAPGEAPAGSGQAAAPELTDEQAQKVLATLPAPY
NTADLANGKAKFALCRSCHTITPGGANMTGPNLHGVFGRKAAQVEGFRYSDALQNADIVW
DGPHLDEWLAKPMTYLPGTKMSFAGLKDAKDRTDLIAFLMVETRGTAQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtctgggaccgatcctcgccaccgccgtcgtcgcggccgccctcgcctcgtgc
ggcaagtcgtcgacggagcaggccccgggcgaggctccggcggggtccggccaggccgcc
gcgcccgaactcaccgacgagcaggcgcagaaggtcctcgccaccctgcctgcgccctac
aacaccgcggacctggcgaacggcaaggcgaagttcgccctctgccgctcgtgccacacg
atcacgcccggcggcgccaacatgaccggcccgaacctgcacggcgtgttcggccgcaag
gcggcccaggtcgaaggcttccggtactccgacgcgctgcagaacgccgacatcgtctgg
gacgggccgcacctcgacgagtggctggccaagccgatgacctacctgcccggcaccaag
atgtcgttcgcggggctgaaggacgccaaggaccggaccgacctgatcgccttcctgatg
gtcgagactcgtgggacggcccagtag

DBGET integrated database retrieval system