KEGG   Phenylobacterium zucineum: PHZ_c1283Help
Entry
PHZ_c1283         CDS       T00750                                 

Definition
lysozyme family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pzu  Phenylobacterium zucineum
Brite
Enzymes [BR:pzu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PHZ_c1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1459881..1461218
Genome map
AA seq 445 aa AA seqDB search
MSPRHRVSRNAIELIKRFEGYRRKAAQLPDGRWTIGYGHTLTAREGAEVSEEDAEALLIY
DLIAVAHAVNEHALVPLTQNQFDALCSFAFNLGLDAFRTSQVLKRLNAGETVQAACAMEL
WRKAEFQGQRIVLDALVRRRSAEKALFLTPPGDAWVPAPSPVLRPLVDLDVRELIPSEAP
TELVASLEGDRVVVSRDGEPLAVPPPIEDETPGGAVRAAAEAVTARLQTIFPENEPEPAP
EPPAEPEAAEPHEVRPQADFAPPITTLADGADEAETTAPPTVTTYPQEPAAPEAAPEWSE
VPPEAPERPEEFPEEFPEEIPEEIPEGALEAPAPANDASLVLDAPFEGRRIVIDDMAVHE
FIPARVAPLPRRKEGGLFAEVALALLGLAFFGFGIFWGLNARAGAVAAFPNPLLVAWAAG
VAGVGFFVVAVYRLLERLGRLTERD
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgcgtcaccgcgtctcccggaacgccatcgagctgatcaagcggttcgaaggc
taccgccgcaaggccgcccagctgcccgacgggcgctggacgatcggctacggccacacg
ctgaccgcgcgggaaggggccgaggtctcggaagaggacgccgaggcgctgctcatctac
gacctgatcgcggtggcccacgccgtgaacgagcacgccctcgtcccgctcacccagaac
cagttcgacgccctctgcagcttcgcgttcaacctcgggctcgatgcgttccgcacctcg
caggtgctgaagcggctcaacgccggcgagacggtgcaggccgcctgcgccatggagctg
tggcgcaaggccgagttccagggccagcggatcgtgctggacgccctcgttcgccgccgc
tcggccgagaaggcgctgttcctgaccccgccgggggacgcctgggtcccggcgccgtcg
ccggtgctgcgcccgctggtggacctggacgtccgcgagctgatcccgtccgaggcgccg
accgaactcgtggcctcgctggagggcgatcgggtcgtcgtcagccgcgacggcgagccg
ctggccgtgccgccgccgatcgaggacgagacgccgggcggggcggtccgcgccgccgcc
gaggcggtgaccgcgcgcctgcagaccatcttccccgagaacgaaccggaaccggcgccc
gagcctcccgccgagccggaagcggccgagcctcacgaggtgcgcccgcaggccgatttc
gcgccgccgatcaccaccctggccgacggcgcggacgaggctgagacgaccgcgccgccg
accgtcacgacctatccgcaggagcccgcagcgcccgaagcggcgcctgaatggtccgag
gtcccgcccgaggccccggagcgccccgaggagttccccgaggagttccccgaggagatc
ccggaggagattccggagggcgccctggaggctcccgcgccggccaacgacgccagtctg
gtcctcgacgctccgttcgaggggcggcggatcgtgatcgacgacatggcggtgcacgag
ttcatccccgcccgtgtcgccccgctgccgcgcaggaaggagggcggcctgttcgccgag
gtcgccctggcgctgctgggtctggccttctttgggttcggcatcttctggggcctgaac
gcccgggccggggcggtcgcggccttcccgaatccgctgctggtcgcctgggcggcgggg
gtcgccggcgtgggcttcttcgtggtcgccgtctaccgcctgctggagcgcctgggccgc
ctgaccgagcgggactag

DBGET integrated database retrieval system