KEGG   Phenylobacterium zucineum: PHZ_c1341Help
Entry
PHZ_c1341         CDS       T00750                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pzu  Phenylobacterium zucineum
Brite
Enzymes [BR:pzu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PHZ_c1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1520079..1520645
Genome map
AA seq 188 aa AA seqDB search
MADFAAARLNMVESQVRTQDVTDVRLHDAMRDLPRERFAPEGKAYLAYADVEVEYAPGRW
LLKPRDVAKLLQEVRPMPGERALAIAAPYAAAVLEALDLQVTRLDEDLRQVPAGEFDVII
CEGAVARAPEAWVKALAMDGRLAVIERDGPVGQACLYLRAEDGVGRRVLFDATPPVLAGF
EARHGFAF
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttcgccgccgcccgcctgaacatggtggagagccaggtgcgcacccaggac
gtgacggacgtgcgcctgcacgacgccatgcgcgacctgccgcgcgagcgcttcgcgccc
gagggcaaggcctatctggcctacgccgacgtcgaggtggagtacgcgcccggccgctgg
ctgctgaagccccgcgacgtcgccaagctgctgcaggaagttcgcccgatgcccggcgag
cgcgccctcgccatcgccgccccctacgccgcggccgtgctggaggcgctggacctgcag
gtcacgcggctggacgaggacctccggcaggtcccggccggcgagttcgacgtcatcatc
tgcgagggcgccgtcgcccgcgcccccgaggcctgggtgaaggccctggccatggatggc
cgcctggcggtcatcgagcgggacgggccggtcggccaggcctgcctctacctgcgggcc
gaggacggagtcggccgccgtgtcctgttcgacgccacgcccccggtgctcgcgggcttc
gaggcccgtcacggtttcgccttctga

DBGET integrated database retrieval system