KEGG   Phenylobacterium zucineum: PHZ_c1359Help
Entry
PHZ_c1359         CDS       T00750                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00900  Terpenoid backbone biosynthesis
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PHZ_c1359
Enzymes [BR:pzu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PHZ_c1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACG77773
UniProt: B4R9A3
Position
1541105..1542028
Genome map
AA seq 307 aa AA seqDB search
MGRRRRSSPDSRVPAVFAPAKVNLFLHVGAPEPSGYHPICSLMTFADVGDRVSAAGADAL
DLVVDGPFARELAGEGDNLVLRAARALIAEARRPVPPIALRLEKRLPVASGLGGGSSDAG
AALRLMREALALDVSDARLEAVAASLGADGAACLWGRPALAQGRGERLSPAPAMPVLDAV
LVNPGAPVSTADVYRRFDAAGAFGSVEPPAAPEAFESPQEVAAWLAGQRNDLEAPALAVA
PAVGAALETLRAEPETLLARVSGSGGTCFALCAGDIEAESLAERLQALAPDWWVVRCRLG
GPSPDAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgggccgcaggcgccgaagctcgccggacagtagggtgcccgccgtcttcgcgccggcc
aaggtcaacctcttcctgcacgtgggcgcgccggagccctcgggctaccacccgatctgc
agcctgatgacgttcgccgacgtgggcgaccgggtcagcgcggccggggccgacgccctg
gatctcgtggtggacgggccgttcgcccgcgagctggcgggggagggcgacaacctcgtc
ctgcgcgccgctcgcgcgctgatcgccgaggcgcgccggccggttccaccgatcgcgctg
cgcctggagaagcgcctgccggtggccagcggcctgggcggcggctccagcgacgccggc
gcggccttgcggctgatgcgcgaggcgctggcgctcgacgtttccgacgcgcggctggaa
gccgtggcagctagcctcggggcggacggcgccgcctgcctctggggacgtcccgcactc
gcccaggggcggggcgagcgtctttcgcccgcgccggccatgccggtcctcgacgcggtg
ctggtcaatccgggcgcgcccgtctccactgccgacgtctaccggcgcttcgacgcggcc
ggcgccttcgggtccgtggagccgcccgcagcgcccgaagcgttcgagagtccccaggag
gtcgccgcctggctggccggccagcgcaacgatctggaggccccggcgctcgccgtcgca
ccggcggtcggcgcggcgctggagaccctgcgcgccgagcccgagaccctgctggcgcgc
gtgtccggctcgggcggcacctgcttcgccctgtgcgccggcgacatcgaggccgagagc
ctggccgagcggctgcaggccctggcgccggactggtgggtcgtccgctgccggctcggc
ggcccctcgccggacgcggcctga

DBGET integrated database retrieval system