KEGG   Phenylobacterium zucineum: PHZ_c1563Help
Entry
PHZ_c1563         CDS       T00750                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pzu  Phenylobacterium zucineum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pzu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1764523..1765188
Genome map
AA seq 221 aa AA seqDB search
MSPHDEHARPWETVRRGLLLLISSPAGAGKTSLSRRLVADHSDLTLSISATTRDPRPGEE
EGREYFFKTRAEFEAMIEAGEFLEWATVNGNYYGTPKTPVIEALEGGHDVLFDIDWQGAR
QIAEKQPDDSVRVFILPPVWSDLERRLRARAQDSEEIIDARLRLGREEIAHWTEYDYVIV
NKNFDRAYADLGHIYRAERMKPGRNPWLPEFVDGLLEDAAG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcatgacgaacacgcccggccctgggagaccgtccgccgcggcctgctgctg
ctgatctcgagccccgcgggggcgggcaagacctcgctgtcgcgccggctcgtggcggac
cactcggacctgacgctgtcgatctcggcgaccacccgcgatccgcggccgggcgaggag
gaagggcgggagtacttcttcaagacccgcgccgagttcgaggcgatgatcgaggcgggc
gagttcctggagtgggcgaccgtcaacggcaactactacggcaccccgaaaacgcccgtg
atcgaggcgctggaaggcggccacgacgtgctgttcgacatcgactggcagggcgcgcgg
cagatcgccgagaagcagcccgacgacagcgtgcgggtgttcatcctgccgccggtgtgg
agcgacctggagcggcgcctgcgggcccgggcccaggacagcgaggagatcatcgacgcc
cggctgcggctggggcgcgaggagatcgcccactggaccgagtacgactacgtcatcgtc
aacaagaacttcgaccgcgcctacgccgacctcggccacatctaccgcgccgaacggatg
aagcccggccgcaacccgtggctgcccgagttcgtcgacgggctgctggaggacgcggcg
gggtag

DBGET integrated database retrieval system