KEGG   Phenylobacterium zucineum: PHZ_c1712Help
Entry
PHZ_c1712         CDS       T00750                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pzu  Phenylobacterium zucineum
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    PHZ_c1712
Enzymes [BR:pzu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PHZ_c1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1921241..1922290
Genome map
AA seq 349 aa AA seqDB search
MSSDVETSLRGPKAYALARKAIEAMEAHQVWPTALNFELWVHYVAAKDSALATEIDHLIE
AGEPFTDAVGEQLAAQFLPKAKLNGEILEAGQTLSKELDSVSRAIESARETSEAYGQQLA
SASESLDGEDAQAIKSMVETLTVATRKVREENHALESQLQDTTAELGRLREHLEQVRRDA
MTDALSGLANRKAFDEALERACDQGEQGGPVTLAVIDIDHFKSFNDTWGHQTGDQVIRYV
ASVIQRCSPAPRVSARYGGEEFAIIFPGESARDSLAVLEAVREEVSSRILKRRSTNEDLG
AITISAGIAERKPGESPASLVERADSALYASKRGGRNRTSCADPIAAAA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgacgtcgaaacatcgctccggggcccgaaggcctacgcgctggcccgcaag
gcgatcgaggccatggaagcgcaccaggtctggccgaccgcgctcaacttcgagctctgg
gtgcactacgtcgcggccaaggattccgccctggccaccgagatcgaccatctgatcgag
gccggcgaaccgttcaccgatgcggtgggcgagcagctggccgcccagttcctgcccaag
gccaagctgaacggcgagatcctcgaggcgggtcagaccctgtcgaaggaactggacagc
gtctcgcgcgccatcgaatccgcccgcgagacctccgaggcctacggccagcagctggcc
agcgccagcgagtcgctcgacggcgaggacgcccaggcgatcaagtcgatggtcgagacc
ctgactgtcgccacgcgcaaggtgcgggaggagaaccatgcgctggaaagccagctgcag
gacacgaccgccgaactcggccgcctgcgcgagcacctggagcaggtgcgccgcgacgcg
atgaccgacgccctttcggggctggccaaccgcaaggccttcgacgaggcgctggagcgg
gcctgcgaccagggcgaacagggcggcccggtgaccctggcggtcatcgacatcgaccat
ttcaagagcttcaacgacacctggggccaccagacgggcgaccaggtgatccgctacgta
gccagcgtgatccagcgctgcagccccgccccgcgggtttcggcgcgctacggcggcgag
gagttcgccatcatcttccccggcgagagcgcccgggactcgctggcggtcctggaggct
gtgcgcgaggaggtctcgtcccgcatcctcaagcgccgctcgaccaacgaggacctcggg
gcgatcacgatctcggccggcatcgccgagcgcaagccgggggaaagccccgccagcctc
gtcgagcgcgccgacagcgccctctacgcctccaagcgcggcggccgcaaccgcacctcc
tgcgccgatccgatcgccgcggcggcctga

DBGET integrated database retrieval system