KEGG   Phenylobacterium zucineum: PHZ_c1712Help
Entry
PHZ_c1712         CDS       T00750                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pzu  Phenylobacterium zucineum
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    PHZ_c1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1921241..1922290
Genome map
AA seq 349 aa AA seqDB search
MSSDVETSLRGPKAYALARKAIEAMEAHQVWPTALNFELWVHYVAAKDSALATEIDHLIE
AGEPFTDAVGEQLAAQFLPKAKLNGEILEAGQTLSKELDSVSRAIESARETSEAYGQQLA
SASESLDGEDAQAIKSMVETLTVATRKVREENHALESQLQDTTAELGRLREHLEQVRRDA
MTDALSGLANRKAFDEALERACDQGEQGGPVTLAVIDIDHFKSFNDTWGHQTGDQVIRYV
ASVIQRCSPAPRVSARYGGEEFAIIFPGESARDSLAVLEAVREEVSSRILKRRSTNEDLG
AITISAGIAERKPGESPASLVERADSALYASKRGGRNRTSCADPIAAAA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgacgtcgaaacatcgctccggggcccgaaggcctacgcgctggcccgcaag
gcgatcgaggccatggaagcgcaccaggtctggccgaccgcgctcaacttcgagctctgg
gtgcactacgtcgcggccaaggattccgccctggccaccgagatcgaccatctgatcgag
gccggcgaaccgttcaccgatgcggtgggcgagcagctggccgcccagttcctgcccaag
gccaagctgaacggcgagatcctcgaggcgggtcagaccctgtcgaaggaactggacagc
gtctcgcgcgccatcgaatccgcccgcgagacctccgaggcctacggccagcagctggcc
agcgccagcgagtcgctcgacggcgaggacgcccaggcgatcaagtcgatggtcgagacc
ctgactgtcgccacgcgcaaggtgcgggaggagaaccatgcgctggaaagccagctgcag
gacacgaccgccgaactcggccgcctgcgcgagcacctggagcaggtgcgccgcgacgcg
atgaccgacgccctttcggggctggccaaccgcaaggccttcgacgaggcgctggagcgg
gcctgcgaccagggcgaacagggcggcccggtgaccctggcggtcatcgacatcgaccat
ttcaagagcttcaacgacacctggggccaccagacgggcgaccaggtgatccgctacgta
gccagcgtgatccagcgctgcagccccgccccgcgggtttcggcgcgctacggcggcgag
gagttcgccatcatcttccccggcgagagcgcccgggactcgctggcggtcctggaggct
gtgcgcgaggaggtctcgtcccgcatcctcaagcgccgctcgaccaacgaggacctcggg
gcgatcacgatctcggccggcatcgccgagcgcaagccgggggaaagccccgccagcctc
gtcgagcgcgccgacagcgccctctacgcctccaagcgcggcggccgcaaccgcacctcc
tgcgccgatccgatcgccgcggcggcctga

DBGET integrated database retrieval system