KEGG   Phenylobacterium zucineum: PHZ_c1741Help
Entry
PHZ_c1741         CDS       T00750                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00010  Glycolysis / Gluconeogenesis
pzu00020  Citrate cycle (TCA cycle)
pzu00620  Pyruvate metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
Module
pzu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c1741 (aceF)
   00020 Citrate cycle (TCA cycle)
    PHZ_c1741 (aceF)
   00620 Pyruvate metabolism
    PHZ_c1741 (aceF)
Enzymes [BR:pzu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PHZ_c1741 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 DUF2118 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACG78152
UniProt: B4RBV5
Position
complement(1950683..1952023)
Genome map
AA seq 446 aa AA seqDB search
MTDILMPALSPTMEEGTLAKWHVKQGDAVRSGDVIAEIETDKATMEVEAVDEGVVSEILV
PEGTEGVKVNTPIARLGGEGEAAAPAPQPKAEAPKPAPTPESDGARAAREEKTEAAAKTP
AQAPAPAPSPARAQDGSRIFASPLARRLAEQKGVDLSAVKGTGPHGRIVKADIEQARPGE
TKPGEAKAPAAQPTAAPSAARAEPRPAASLEQMGIAPGSYDLIPLDGMRKTVARRMTDSF
RDVPHFPLTIDLEIDGLLAARARINALLEKEGVKVSVNDMVMKAAAVALKRVPEANASYT
PEGIAMHHHADIAMAVAVPGGLITPIIRKAETKGLAQIATEAKDLAERARNKKLKPEEFQ
GGTFSVSNLGMFGIKTFSSILNEPQGCILSVGAGEKRPVVRGDKLEIATLMSVTLTCDHR
VVDGATGARWLQAFKALIEEPLTMIV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatcctcatgcccgccctgtctccgaccatggaggagggcaccctcgccaaa
tggcacgtgaagcagggcgacgccgtccgctcgggcgacgtcatcgccgagatcgagacc
gacaaggccaccatggaggtcgaggcggtcgacgaaggcgtcgtctccgagatcctggtg
ccggaaggaaccgagggcgtgaaggtgaacacgcccatcgcccgcctgggcggcgaaggc
gaggcggccgctccggcgccgcagccgaaggccgaggcgccgaagcccgcgccgaccccc
gagagcgacggcgcccgcgccgcccgcgaggagaagaccgaggccgcggccaaaactccg
gcccaggctcccgcgccggccccctcgccggccagggcgcaggacggctcgcggatcttc
gcctcgcctcttgcccgccggctggccgagcagaagggcgtcgacctctcggcggtgaag
ggcaccgggccgcacggccggatcgtcaaggccgacatcgagcaagcccggcctggcgag
accaagcccggtgaagcgaaggcgccggcggcccagccgaccgctgcgccctcggcggcg
cgcgccgaaccgcgcccggcggcgagcctggagcagatgggtatcgcgcccggcagctac
gacctcatcccgctggacggcatgcgcaagaccgtcgcccggcggatgaccgacagcttc
cgggacgtgccgcacttcccgctgaccatcgacctcgagatcgacggcctgctggccgcc
cgcgcccggatcaacgctttgctcgagaaggaaggcgtgaaagtcagcgtcaacgacatg
gtgatgaaggccgcggccgtggccctgaagcgcgtgcccgaggcgaacgcctcctacacg
cccgagggcatcgccatgcaccaccacgccgacatcgccatggccgtggcggtcccgggg
ggcctgatcacgccgatcatccgcaaggccgagaccaagggcctggcgcagatcgccacc
gaggccaaggacctggccgagcgggcgcggaacaagaagctgaagcccgaggaattccaa
ggcggcaccttcagcgtctccaatctcgggatgttcggcatcaagacgttctcctcgatc
ctcaacgagccgcagggctgcatcctgtcggtcggcgcgggcgagaagcggcccgtggtg
cgcggcgacaagctggagatcgccacgctgatgtccgtgaccctgacctgcgaccaccgg
gtcgtggacggggcgaccggcgcgcgctggctgcaggcgttcaaggcgctgatcgaagag
ccgctgacgatgatcgtctag

DBGET integrated database retrieval system