KEGG   Phenylobacterium zucineum: PHZ_c1755Help
Entry
PHZ_c1755         CDS       T00750                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHZ_c1755 (tpiA)
   01230 Biosynthesis of amino acids
    PHZ_c1755 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHZ_c1755 (tpiA)
   00051 Fructose and mannose metabolism
    PHZ_c1755 (tpiA)
   00562 Inositol phosphate metabolism
    PHZ_c1755 (tpiA)
Enzymes [BR:pzu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PHZ_c1755 (tpiA)
Exosome [BR:pzu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PHZ_c1755 (tpiA)
  Exosomal proteins of bladder cancer cells
   PHZ_c1755 (tpiA)
  Exosomal proteins of melanoma cells
   PHZ_c1755 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1962903..1963646)
Genome map
AA seq 247 aa AA seqDB search
MTAPKPLIAGNWKMNGLAAALSEAKAVAAGAAASAARVAICPPSLLVHRMSEALAGTPVL
VGGQDCHTDESGAFTGDVSAEMLADAGAKLVILGHSERRSGYRETDALVAGKVKAALRAG
LEPIVCVGETLEERKAGQALAIVTRQVRGSLPTELAGKAFAVAYEPVWAIGTGLTPTTPE
IEEMHRAIRATLVEMFGEAGRAVPILYGGSVKPSNAAEILHADEVGGALVGGASLKAQDF
LGIVNAL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccaagccgctgatcgccggaaactggaagatgaacgggctggccgccgcg
ctgtccgaggccaaggccgtggccgccggggcggccgcgagcgccgcgcgcgtggcgatc
tgtccgcccagtctgctggtccaccggatgagcgaggcgctggcggggacgccggtgctg
gtcggcggtcaggactgccacacggacgaatcgggcgccttcaccggcgacgtctcggcc
gagatgctggccgacgccggcgcgaagctggtgatcctcggccactccgagcggcggtcg
ggctaccgcgagaccgacgccctggtggcgggcaaggtcaaggcggcgctgcgcgcgggg
ctggagccgatcgtctgcgtcggcgagacgctggaggagcgtaaggccggccaggcgctg
gcgatcgtcacgcgccaggtccgcggctcgctgccgaccgagctggcgggcaaggccttc
gcggtggcctatgagcccgtgtgggcgatcggcaccggcctgacgcccaccacgcccgag
atcgaggaaatgcaccgcgcgatccgggccaccctggtcgagatgttcggcgaggcgggc
agggcggtccccatcctgtacggcggctcggtgaagccgtcgaacgcggccgagatcctg
cacgccgacgaggtgggcggcgcgctggtgggcggcgcgtccctgaaggcgcaggacttc
ctcgggatcgtgaacgccctctag

DBGET integrated database retrieval system