KEGG   Phenylobacterium zucineum: PHZ_c1854Help
Entry
PHZ_c1854         CDS       T00750                                 

Definition
(RefSeq) NADH dehydrogenase
Organism
pzu  Phenylobacterium zucineum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2076120..2076524)
Genome map
AA seq 134 aa AA seqDB search
MSVLKTIFTWWNGATAGVRFTIAKRGVFVGQDDFGNRYYEAKDTRDSYDPKRKRRWVVFN
GYAEASKVPPDWHGWLHHTFEEPPTTAPLPRKRWEKEHRPNLSGTIYAYRPKGSLARGGE
RQRATGDYEAWTPE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtcctcaagaccatcttcacctggtggaacggcgccaccgccggcgtccggttc
acgatcgccaagcgcggcgtcttcgtcgggcaggacgatttcggcaaccgctactacgag
gccaaggacacgcgggacagctacgatcccaagcgcaagcggcgctgggtggtgttcaac
ggctacgccgaggcgtccaaggttccgccggactggcacggctggctgcatcacaccttc
gaagagccgccgacgacggcgcccctgccgcgcaagcgctgggagaaggagcaccggccg
aacctgtcggggaccatctacgcctaccgaccgaagggctccctcgcccgcggcggcgag
cgccagcgcgccaccggcgactacgaggcgtggaccccggaatag

DBGET integrated database retrieval system