KEGG   Phenylobacterium zucineum: PHZ_c1883Help
Entry
PHZ_c1883         CDS       T00750                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pzu  Phenylobacterium zucineum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pzu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2109617..2110129)
Genome map
AA seq 170 aa AA seqDB search
MAGVLDSDRAVVVALGGNLPDGFGSSEALLEAVLARFPDAGLKILVRSSWWRSAAWPDPM
APEYRNGVALVEATAPPKEVLERLLSLEAAFGRTRSLRNAARTVDLDLIAYGREVRDAPG
LVLPHPRAHERLFVMGPLAEIAPEWRHPVLGRTAAELARAATVGLDARPV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttggcaggggtcctggatagcgatcgggcggtcgtcgtcgccctgggcggcaacctgccg
gacggcttcggctcgtccgaggcgctgctggaggcggttctggcgcgcttccccgacgcg
gggctgaaaatcctcgttcggtcgtcctggtggcgctcggccgcctggcccgacccaatg
gcgcctgagtaccgcaacggcgtcgcgcttgtcgaggcgacggcgcccccgaaagaggtg
ctggagaggcttctgtccctcgaagcggcgttcggacgcacgagatcgctcaggaatgcg
gcgcggacggtggatctcgacctgatcgcctacgggcgcgaggtgcgggacgcgcccggc
cttgtcctgccccacccgcgagcgcacgagcggctgttcgtcatgggcccgctggccgag
atcgccccggagtggcgtcatccggtgctgggccgcaccgccgccgagctggcccgcgcc
gccaccgtggggctggacgccaggcctgtctga

DBGET integrated database retrieval system