KEGG   Phenylobacterium zucineum: PHZ_c1958Help
Entry
PHZ_c1958         CDS       T00750                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pzu  Phenylobacterium zucineum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2192490..2193161)
Genome map
AA seq 223 aa AA seqDB search
MSEPPIPADGDTPETRMARLILALRSQGVSDAKVLNAIEKTPRELFTPELFKERAFEDSA
LPIACGQTISQPFIVGLMSQALKVDKRDRVLEIGTGSGYQTAILSKLARLVYTVERYRTL
MREAEARFKALGLTNIITRFGDGGEGWPEQAPFDRIMVTAAAPGEPKALLSQLKPSGILV
APIGKGPVQTLRRYTGDGKGGFEVEDLIDVRFVPLLEGVAKEL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccccgatccccgccgacggcgacacgcccgaaacccggatggcccggctg
atcctggcgttgcggtcccagggcgtcagcgacgccaaggtgctgaacgccatcgagaag
accccgcgcgagctgttcacgcccgagctgttcaaggagcgtgcgttcgaggattcggcc
ctgccgatcgcctgcggccagaccatcagccaaccgttcatcgtcggcctgatgtcccag
gcgctgaaggtcgacaagcgcgaccgcgtgctcgagatcggcaccggcagcggctaccag
acggcgatcctctcgaagctggcgcggctggtctacacggtcgagcgctaccgcacgctg
atgcgcgaggccgaggcgcgcttcaaggcgctgggcctcaccaacatcatcacccggttc
ggcgacggcggggaggggtggcccgaacaggcgcctttcgaccgcattatggtcacggcg
gcggcgccgggagagcccaaggcgttgctgtcgcagctcaagccgagcgggatcctggtc
gcgcccatcggcaaggggccggtgcagacccttcgccgctacaccggcgacgggaagggc
gggttcgaggtcgaggacctcatcgacgtccgcttcgtgcccctgctcgaaggcgtggcc
aaggaactctga

DBGET integrated database retrieval system