KEGG   Phenylobacterium zucineum: PHZ_c2201Help
Entry
PHZ_c2201         CDS       T00750                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pzu  Phenylobacterium zucineum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pzu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHZ_c2201
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PHZ_c2201
Enzymes [BR:pzu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PHZ_c2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2485552..2486850)
Genome map
AA seq 432 aa AA seqDB search
MRLDRIAIVGGARLKGEIPISGAKNSAIKLMAASLLTEEPLRLTNMPRLADTRFLGKLLQ
RLGAEVVESDGPEGSETLLTTREIVSGFAPYDLVRQMRASFNVLGPLLARSGQAKVSLPG
GCTIGARPVDLHLQALEALGARIDLHEGYVYAQAPRGLRGAEIEFPFVSVGATEHTLLAA
VLAKGDTEIRNAACEPEIEDLADCLNKMGAKVSGAGTSVIQIEGVARLSGATHAVLADRI
ETGTYALAAAMAGGEVRLTRTRSDFIQALVDKMVEAGVEVTAHNDGLTVKRNGGRLKAVD
VETDPYPGFATDLQAQFMALMTLAEGESVIKETIFENRFMHAPELRRLGADITVHGGEAR
VRGVEALEGAQVMATDLRASVSLVIAGLAARGETVVNRVYHLDRGFERLEEKLGACGAQI
RRIKGDGTGEED
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgcgattggaccgcatcgccattgtcggcggcgcgcggctgaagggggagatcccgatc
agcggcgccaagaactccgcgatcaagctgatggcggcgagtctcctcaccgaggagccg
ctgcggctgaccaacatgccgaggctcgccgacacgcggtttctgggcaagctgctgcag
aggctcggcgccgaggtcgtggagtccgacgggccggagggatccgagaccctgctcacg
acccgcgagatcgtcagtgggttcgcgccctacgacctggtccgccagatgcgggcctcg
ttcaacgtgctggggccgcttttggcgcgctcggggcaggccaaggtgtcgctacccggc
ggatgcacgatcggcgcgcggccggtggatctgcacttgcaggcgctcgaggcgctcggc
gctcggatcgacctgcacgaaggctatgtctacgcccaggccccccgcgggcttaggggc
gccgagatcgagtttcccttcgtatccgtgggcgccacggagcacacactgctcgcggcg
gtgctggctaaaggcgataccgagatccgcaacgcggcgtgcgagcccgagatcgaggat
ctcgccgactgcctcaacaagatgggggccaaggtttccggcgcgggcacctcggtgatc
cagatcgaaggcgtcgcgcggttgtcgggagcgacgcacgcggtgctcgccgaccgaatc
gagaccggcacctatgcgctggcggcggcgatggccggcggcgaggtgcgcctgacccgc
acccggagcgacttcattcaggcgctggtcgacaagatggtcgaggccggcgtcgaggtg
acggcccacaacgacgggctgaccgtgaagcggaacggcggacggctgaaggccgtggac
gtggagaccgatccctatccgggcttcgccacggacttgcaggcgcagttcatggcgctg
atgacgctggccgaaggcgaaagcgtcatcaaggagaccatcttcgagaaccggttcatg
catgcgcccgagctgcgacggctcggcgccgacatcaccgtccatggcggcgaggcgcgc
gtgcggggcgtcgaggctctcgaaggcgcccaggtgatggccacggacctgcgcgcgtcg
gtgagcctggtgatcgccggccttgcggcccgaggcgaaacggtcgtcaaccgcgtttac
cacctcgaccgcggtttcgagcgcctggaagagaagcttggcgcgtgcggggcgcagatc
cgccgcatcaagggcgacggaacgggcgaggaggactga

DBGET integrated database retrieval system