KEGG   Phenylobacterium zucineum: PHZ_c2481Help
Entry
PHZ_c2481         CDS       T00750                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pzu  Phenylobacterium zucineum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2844392..2845528)
Genome map
AA seq 378 aa AA seqDB search
MTSAVSRRQMMALAGAAALAGGAAPAGESLDALARRKGVRFGTAVGLGETRGNSFDDPAF
RALIAHECGLIVAENEHKWYVLRPSADSYDFGPADRLAAFAAERGLGLRGHTLLWSRDEF
SAKWLAAHDFGPRPRAAAERMLVEHIRAVTARYPQVDSWDVVNETIDPATGELRDTILGR
QIGPEIVEIAFHEAKAAAPKARLIYNDYMNFGDEEAVHRKGVLKLLERLKARGVPIDALG
VQGHIGGGVDSTPVERFTAADQRDWRAFLDEVRGMGLDLLITEFDVNCRAMPADLARRDA
EVAALGGDFLGMMLDYRELKQVLVWGLADGASWLQGTTPRADGLPKRPTPYDDRLRSKPL
REAMAAAFRAAPERTAWA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcagccgtttcccgcaggcagatgatggcgctcgccggcgccgcggctctggcc
gggggcgcggcgccggccggggagtccctggacgcgctggcccggcgcaagggggtgcgg
ttcggcacggcggtggggctcggcgagacccgcggcaacagcttcgacgatccggccttc
cgggcgctgatcgcccacgagtgcgggctgatcgtcgccgagaacgagcacaagtggtac
gtgctgcgcccgtcggccgacagctacgacttcggcccggcggaccgcctggcggcgttc
gcggccgagcgcggcctgggcctgcgcggccacaccctgctctggagccgcgacgagttc
tcggccaagtggctggccgcgcacgacttcggcccgcggccgcgggcggcggccgagcgg
atgcttgtcgagcacatccgcgccgtcacagcccgctatccccaggtcgactcctgggac
gtcgtcaacgagacgatcgacccggcgacgggcgaactgcgagacacgatcctcggccgg
cagatcgggcccgagatcgtcgagatcgccttccatgaggccaaggccgccgcgcccaag
gcccggctgatctacaacgactacatgaatttcggcgacgaggaggcggtccaccgcaag
ggcgtcctcaagctgctcgagcggctcaaggcccgcggcgtcccgatcgacgccctgggc
gtccagggacacatcggcggaggcgtggactccaccccggtcgagcgcttcaccgccgca
gaccagcgcgactggcgcgccttcctcgacgaggtccgcggcatgggcctggacctgctg
atcaccgagttcgacgtcaactgccgggccatgcccgccgacctggcgcggcgcgacgcc
gaggtggcggcgctcggcggcgacttcctcggcatgatgctggactaccgcgagctgaag
caggtgctcgtctggggcctggcggacggggcctcctggctgcagggcacgacgccgcgg
gccgacggcctgcccaagcggccgacgccctacgacgaccggctgcggtccaagcccctg
cgcgaggccatggcggccgccttccgcgccgcgccggagcggacggcgtgggcgtga

DBGET integrated database retrieval system