KEGG   Phenylobacterium zucineum: PHZ_c2483Help
Entry
PHZ_c2483         CDS       T00750                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pzu  Phenylobacterium zucineum
Brite
Enzymes [BR:pzu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PHZ_c2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2846586..2847674
Genome map
AA seq 362 aa AA seqDB search
MRLLDRRGLLAGLAAGPLLLAAPRPGAQALPNGPSLAAAAARGGRYFGAAARIDQIRAER
ALRRTVLRDCAWITPEFHMNWDYVAPRSGAWNFRDADGLVAFAGEAGLKVRGHSLIWDQS
TPAWAAAEMVERRDWETVARHFQRVMGRWGERVQAWDVVNEPIARDGRGLLPSMFLEAYG
PDYVRRAFDEARALQPQARLAVNDYGFDYDNPVEEARRGSFLRLLEDLKAKGAPVDEVGI
QAHLDLGKGPLRRRIVAPFLREIGQMGYRIVISELDVRERDFTLPLVERDRRVADEVRAY
LEIALAEPAVEGVVTWGLSDRHSWLQDDEAAALGGVNRGLPYDHGLRPKPMYWALRDTLA
AA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctggatagacgcggactgctggccggcctggccgccggcccgctgctcctg
gccgcgcccaggccgggcgcccaggccctgccgaacgggccctcgctggccgccgccgcg
gcccgcggcgggcgctacttcggcgccgcggcccgcatcgaccagatccgcgccgagcgc
gccctgcgccggaccgtgctccgcgactgcgcctggatcacgcccgagttccacatgaac
tgggactacgtcgccccgcgctccggcgcctggaacttccgcgacgccgacggcctcgtg
gccttcgccggcgaggccgggctgaaggtccgcggccacagcctgatctgggaccagagc
acccccgcctgggccgcggccgagatggtggagcgccgggactgggagaccgtcgcccgc
cacttccagcgggtgatgggacgctggggcgaacgggtgcaggcctgggacgtggtcaac
gagccgatcgcccgcgacggccggggcctgctgcccagcatgttcctagaggcctatggc
ccggactacgtccgccgcgccttcgacgaggcccgggcgcttcagccgcaggcgcgcctg
gccgtcaacgactacggcttcgactacgacaatcccgtcgaggaggcccggcgaggcagc
ttcctgcgcctgctggaagacctgaaggcaaagggcgcgccggtggacgaggtcgggatc
caggcgcacctcgatctcggcaaggggccgctcaggcggcgcatcgtggccccgttcctg
cgcgagatcggccagatgggctaccggatcgtcatctccgagctggacgtgcgcgagcgg
gacttcacccttcccctggtcgagcgcgaccggcgcgtggccgacgaggtccgcgcctac
ctcgagatcgccctggccgagccggcggtggagggcgtggtcacctggggcctctccgac
cggcactcctggctgcaggacgacgaggccgcggcgctgggcggggtcaaccgcggcctg
ccctacgaccacggcctgcgccccaagcccatgtactgggccctgcgcgacaccctggct
gcggcctga

DBGET integrated database retrieval system