KEGG   Phenylobacterium zucineum: PHZ_c2808Help
Entry
PHZ_c2808         CDS       T00750                                 

Definition
cation-transporting ATPase
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
pzu  Phenylobacterium zucineum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3219543..3221717)
Genome map
AA seq 724 aa AA seqDB search
MALTYEAAGGPDFSAFLKRREDGRATLDLLVRGARCAGCMSKIEREVQAVPGVASARMNL
TSGKLAVAFKGASGDPAAVIGALEKLGYPATPYDPAQAQAAHDREGRRLILAMAVAAFGA
MNTMMFSVPIWAGLFGQELGPATRTVMMWFSGAVGAPCAIYAGMPFFQSAWRSLKAGRAN
MDVPISIGVILTLVISFSETVLQGRDAYFDAAVSLLFLLLIGRWLDHQLRAKARSAAGDL
LALQAPAAIRLDEAGGEHRVPLSDILPGDRLLVRPGERLPVDAVIEDGLSELDNSLLTGE
TAPAAVRPGQLCRAGALNLSGVLRLRAEARSEDSALSAIARLVEAGAQAKSKYVQWADKA
AAIYVPVVHTVAALTFAGGWALGLGPREALIRAVAVLIVTCPCALGLAVPAVQITASARL
FRKGVLVKSGAALERLAGVDHVVFDKTGVLTEGRPKLVDPAPAAVALAAPLARASRHPLA
RALAAEAGEGAMASDVREHAGLGVEGLIGGRRARLGRASFVGVESHAAGETELWFGFEGE
TKIRFRFSDALRADAAETIAALKARGLSVEVLSGDVPAAVARAAGAAGIAHWRGGLSPQD
KAEAIDALAAQGRKVLMVGDGLNDAAALAKAHAAMAPGSALEASQNAADLVFSGEGLSAV
VEAVDLARTARKRAMENFGFAALYNVVAAPAAMLGFVNPFVAALAMSGSSLAVTLNALRT
GARR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgacctacgaggcggccggcgggcccgacttctcggccttcctgaagcgccgc
gaggacggccgcgcgacgctggacctgctggtgcgcggcgcccgctgcgccggctgcatg
tcgaagatcgagcgcgaggtccaggccgtccccggcgtggcctcggcgcgcatgaacctc
acctcgggcaagctggcggtggccttcaagggcgcctcgggcgacccggccgcggtgatc
ggcgcccttgagaagctgggctatccggccacgccgtacgacccggcccaggcccaggcc
gcccacgaccgcgagggccgccggctgatcctggccatggccgtggcggccttcggcgcc
atgaacaccatgatgttctcggtccccatctgggccgggctgttcggccaggagctggga
ccggccacccgcacggtgatgatgtggttctcgggcgccgtcggcgcgccctgcgccatc
tacgccggcatgccgttcttccagtcggcctggcgctcgctgaaggccggccgcgccaac
atggacgtgccgatctcgatcggcgtgatcctgaccctggtcatcagcttctccgagacg
gtgctgcagggccgcgacgcctatttcgacgccgccgtcagcctgctcttcctgctgttg
atcggccgctggctggaccaccagctgcgggccaaggcgcgcagcgccgcgggcgacctc
ctggcgctgcaggcgccggccgcgatccgcctggacgaggcgggcggcgagcaccgcgtg
cccctctccgacatcctgccgggcgaccgcctgctggtccgcccgggcgagcgcctgccg
gtggacgcggtcatcgaggacgggctctccgagctcgacaattccctgctcaccggcgag
accgcgccggccgccgtgcgccccggacagctctgccgggccggcgccctgaacctctcg
ggcgtgctgcgcctgcgggccgaggcgcggtccgaggactccgcgctctccgccatcgcc
cgcctggtcgaggccggggcccaggcgaagtcgaagtacgtccagtgggccgacaaggcc
gcggcgatctacgtgccggtggtccacaccgtcgcggccctgacgttcgccggcggctgg
gccctgggccttggaccgcgcgaggcgctgatccgcgcggtcgcggtgctgatcgtcacc
tgcccctgcgccctgggcctggccgtgcccgcggtgcagatcaccgcctcggcgcggctg
ttccgcaagggcgtgctggtgaagtccggcgcggccctggagcgcctggccggcgtcgac
cacgtcgtgttcgacaagaccggcgtcctcaccgaggggcggccgaagctggtggacccg
gctcccgccgccgtggcgctcgccgccccgctggcccgggcctcgcgccatccgctggcc
cgcgccctggccgccgaggccggggagggggcgatggcgagcgacgtgcgcgagcacgcc
ggcctcggcgtcgagggcctcatcggcggccgccgcgcgcgtctcggccgcgcgtccttc
gtgggcgtcgagagccacgccgccggcgagaccgagctgtggttcggattcgagggcgag
accaagatccgcttccgcttcagcgacgccctgcgcgccgacgcggccgagaccatcgcc
gcgctgaaggcccggggcctgtcggtggaggtgctgtcgggcgacgtgccggccgccgtg
gcccgcgcggcgggcgccgccgggatcgcccactggcggggcggcctctcgccgcaggac
aaggccgaggcgatcgacgccctcgccgcccagggccgcaaggtgctgatggtgggcgac
gggctgaacgacgccgccgccctggccaaggcgcacgccgccatggcgcccggctcggcc
ctggaggccagccagaacgccgccgacctggtgttctcgggcgagggcctctcggcggtg
gtggaggcggtggatctggcccgcacggcgcgcaagcgggcgatggagaacttcggcttc
gccgcgctctacaacgtggtggccgcgccggccgccatgctggggttcgtcaatccgttc
gtggccgccctcgccatgtcgggctcgtccctggcggtgaccctcaacgcgcttcgcaca
ggagcccgccgatga

DBGET integrated database retrieval system